Conserved Protein Domain Family
PHA02815

?
PHA02815: PHA02815 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165165
View PSSM: PHA02815
Aligned: 3 rows
Threshold Bit Score: 78.8175
Threshold Setting Gi: 21492475
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148912898  1 MVLIIVIVISLYLLFQLVNFFYLLKLFNKIKVKMMNITTKISFDELENAYYIDDTymCVGVNVD 64 
15150460  25 MVLIIVIVISLYLLFQLVNCFYLFDLFNKIKVRMMKLTTRRSFDELENVYYIDDT--CVGVNVD 86 
21492475  16 IVLIIVIVISLYLLFQLVNCFYLFKFLNKVKVKMMNITTKISFDELENVYYIDDTytCVGVNVD 79 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap