Conserved Protein Domain Family
PHA02813

?
PHA02813: PHA02813 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165164
View PSSM: PHA02813
Aligned: 5 rows
Threshold Bit Score: 495.159
Threshold Setting Gi: 148912885
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62637386    1 MYINNNLdkITVNIFKNNCFSDILDCLNAIIKSNDDKWYPSKIYNVYEEGEHIDIYKRKSKQIIIDN-DDVIERVRNKLL 79 
21492462    2 ETISDGI--IKVKTFNDDYFNNVKKIIMDMIKYKKIIWEESKVFDHEKGIEVINTNERQCKQYIIRGlDDIFKVIRKKLL 79 
15150446    2 ETISDGI--IKVKTFNDDYFNNVKKIIMDMIKYKNIIWEESKVFDHEKGIEVINTNERQCKQYIIRGlDDIFKVIRKKLL 79 
148912885   2 ETISDGI--IKVKTFNDDYFNNVKKIIMDMIKYKNIIWEESKVFDHEKGVEVINTNERQCKQYIIRGlDDIFKVIRKKLL 79 
211956281   1 MYINNNLdkITVNIFKNSCFSDILDSLSDIIKSNDDGWDHSKIYNVYEEGEHIDIYKRKSKQFIIEN-NDIIEYIRHTLL 79 
62637386   80 DEFNNNKIIEKIIVDKHITFVKYDCGDHFDNHTDFIQLRSHDCEEYHLILYIQKPKNGGKTKIFLNDDTSIATKENVLFD 159
21492462   80 LSFEFPQKISDIILDNTITLIKYEKGDFFNTHRDFIHFKSKNCYCYHLVLYLNNTSKGGNTNIHIKPNTIFSTKNDVLFD 159
15150446   80 LSFEFPQKISDIILDNTITLIKYEKGDFFNTHRDFIHFKSKNCYCYHLVLYLNNTSKGGNTNIHIKPNTIFSTKNDVLFD 159
148912885  80 LSFEFPQKISDIILDNTITLIKYEKGDFFNKHRDFIHFKSKNCYCYHLVLYLNNTSKGGNTNIHIKSNAIFSTKNDVLFD 159
211956281  80 NEFSNNKIIEKIIVDKHITFVKYDCGDYFDNHTDFVQLRSQDCAEYHLILYVQKPKNGGKTKIFLNDDTSISTKENVLFD 159
62637386  160 KTLIHKSTIVKEGIKIVALFNVIIKYKI-ADDILFTIPYL--DRLITFHKSENNKELCYCYIIINNHLAEVDNFGIILDR 236
21492462  160 KTLNHSSDIITDGEKNIALINVVIKYNSnNDETIFKLPYLseNNYINFYEDEGNRKFCYCLVTVNNYSTEVDTFGLILNR 239
15150446  160 KTLNHSSDIITDGEKNIALINVVIKYNSnNDETIFKLPYLseNNHINFYEDEGNRKFCYCLVTVNNYSTEVDTFGLILNR 239
148912885 160 KTLNHSSDIITDGEKNIALINVVIKYNSnNDETIFKLPYLseNNHINFYEDEGNRKFCYCLVTVNNYSTEVDTFGLILNR 239
211956281 160 KTLVHKSTPVKEGIKIVALINVIIKYKI-ADDILFTIPYL--DRLITFHKSESNKDLCYCYIIINNHLAEVDNFGIILDR 236
62637386  237 SGKCLLVNLYSKVIKKRIVDESFDDMCMEVAFNYQDIkeYFYYLKNEDNKNIAWNTLSKVNKDMWYPMNNNDYTFLEEIV 316
21492462  240 SGKCVLVNKYDNIITEKLIFENFDDMCMEISFSYNDI--IFDYLKNEDGKNIAWKALSSSCDEIWYPKSKNDFDFLKDLV 317
15150446  240 SGKCVLVNKYDDIITEKLIFENFDDMCMEISFSYNDI--IFDYLKNEDGKNIAWKALNSSCDEIWYPKSKNDFDFLKDLV 317
148912885 240 SGKCVLVNKYDDIITEKLIFENFDDMCMEIPFSYNDI--IFDYLKNEDGKNIAWKALNLSCDEMWYPKSKNDFDFLKDLV 317
211956281 237 SGRCLLVNLYSKVIKKRIVDESFDDMCMEVAFNYQDIkeYFYYLRNEDNKNIAWNTLSKVNKEMWYPINNNDYTFLEEIV 316
62637386  317 KNVTDKIiNENIDYYVLSGDCNSEIHYINFKIIKCYFSI 355
21492462  318 KYVNNNL-KDKISYYVLTGNCNSEIHYINFNVVRCYFSI 355
15150446  318 KYVNNNL-KDKINYYVLTGNCNSEIHYINFNVVRCYFSI 355
148912885 318 KYVNNNL-KDKINYYVLTGNCNSEIHYINFNVVRCYFSI 355
211956281 317 KNVTDKMiNENIDYYVLSGDCNSEIHYINFKIIKCYFSI 355
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap