Conserved Protein Domain Family
PHA02811

?
PHA02811: PHA02811 
putative host range protein; Provisional
Statistics
?
PSSM-Id: 165163
View PSSM: PHA02811
Aligned: 3 rows
Threshold Bit Score: 301.21
Threshold Setting Gi: 148912944
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15150506    1 MGIRHELDILLVSENLALKNVELLKGDSYGCTINIKVNQQKKLDFIIILRPDWTEVRNVKKINMVCNGVVIDTTLIKKSF 80 
148912944   1 MGIRHELDILLVSENIALKNVELLKGDSYGCTINIKVNQQKKLDFIIILRPDWTEVRNVKKINMVCNGVVIDTTLIKKSF 80 
21492520    1 MGIRHELDILLVSENLALKNVELLKGDSYGCTINIKVNQQKKLDFIIILRPDWTEVRNVKKINMVCNGVVIDTTLIKKSF 80 
15150506   81 YEEVYSSSVTVFQNTTVEFFSDTSKKYKEEYPIVNINTIKRYYEIKDSRMTCINFESPISDYDQVNYLKDYINISDDYYL 160
148912944  81 YEEVYSSSVTVFQNTTVEFFSDTSKKYKEEYPIVNINTIKRYYEIKDSRMTCINFESPISDYDQVNYLKDYINISDDYYL 160
21492520   81 YEEVYSSSVTVFKNTTVEFFSDTSKKYKEEYPIVNINTIKRYYEIKDSRMSCINFESPISDYDQVNYLKDYINISNDYYL 160
15150506  161 YDACDDCIISSdDDDDNDNADDDEEdDDEVNDIEDDYE 198
148912944 161 YDACDYCIISS-DDDDNDNADNNEE-DDEVNDIEDDYE 196
21492520  161 YDACDYCIISSdDDDDNDNTDNDEE-DDEVNDIEDDYE 197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap