Conserved Protein Domain Family
PHA02807

?
PHA02807: PHA02807 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165161
View PSSM: PHA02807
Aligned: 3 rows
Threshold Bit Score: 244.096
Threshold Setting Gi: 21492533
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148912957   1 MESEIKRLTNIIKERNIICPIDIEKIYNEKFLLLEKGLDETLYAIHIYDSMARFDNGTFFKIAKFLYRNDIDVLKKIFIN 80 
15150519    1 MESEIKRLTNIIKERNIICPIDIEKIYNEKFLLLEKGLDETLYAIHIYDSMARFDNGTFFKIAKFLYRNDIDVLKKIFID 80 
21492533    1 MESEIKRLTNIIKERNIICPIDIEKIYNEKFLLLEKGLDETLYAIHIYDSMARFDNGTFFKIAKFLYRNDIDVFKKIFID 80 
148912957  81 EKKIESINALLPIYSVNIIERKNALIPLTEIPNGSEGILLILLHLFNSFKFNKLTNISTIPYYLPFGKYINNIII 155
15150519   81 EKKIESTNALLPTYSVNIIERKNALIPLTEIPNGSEGILLILLHLFNSFKFNKLTNISTIPYYLPFGKYINNIII 155
21492533   81 EKKIESTNALLPIYSVNIIERKNALIPLTEIPNGSEGIILILLHLFNSFKFNKLTNISTIPYYLPFGKYINDIII 155
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap