Conserved Protein Domain Family
PHA02800

?
PHA02800: PHA02800 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165159
View PSSM: PHA02800
Aligned: 5 rows
Threshold Bit Score: 245.23
Threshold Setting Gi: 211956430
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148913027   1 MDTNtlPFSKHyIHDFTDYDNFEKKNSFSMSYQLTGILQYYFIWRFNgGKVDETTGKIFKEFFKYDTLAKWRFSKRDFEQ 80 
211956430   1 MENN--PFNKR-IHDFSDYDKAEKYDRFLDHYQINGFLQYYLLWRSN-IKQEDNIGKIFKEFLKYDHLARWRFSEKDFND 76 
62637536    1 MENN--PFNKR-IHDFSDYDNAEKYDRFLDHYQINGFLQYYLLWRSN-IRQEDNIGKIFKEFLKYDHLARWRFSEKDFND 76 
15150589    1 MDTNtlPFSKHyIHDFTDYNNFEKKNSFSMSYQLTGILQYYFIWRFNgGKVDETTGKIFKEFFKYDTLAKWRFSKRDFEQ 80 
21492600    1 MNTNtlLFSDNyIHDFTDYDNFEKKNSFSMSYQLTGMLQYYFIWRFNgGKVDENTGKIFKEFFKYDTLAKWRFSKRDFEQ 80 
148913027  81 CKNMLLENDKNISYVLDVPKPEKNDPLLNLKELIGFLAILSEEIKKNTKFFALFNIMNSLFTHTKIDIVNCLKTELQFLY 160
211956430  77 AKDLLIKNDRNTSYILKIPESNDIDLLIDIKEVLGFLAILLEEIKLDINFFAVFNVINSFSKYVNQETLEILKLELQYLY 156
62637536   77 AKDLLIKNDRNTSYILKIPESNDIDLLIDIKEVLGFLAILLEEIKLDINFFAVFNVINSFSKYVNQETLEILKLELQYLY 156
15150589   81 CKNMLLENDKNISYVLDVPKPEKNDPLLNLKELIGFLAILSEEIKKNTKFFALFNIMNSLFTHTKIDIVNCLKTELQFLY 160
21492600   81 CKNMLLENDKNTSYVLDVPKPEKNDPLLNLKELIGFLAILSEEIKKDTKFFALFNIMNSLFKHTKIDIVNCLKTELQFLY 160
148913027 161 P 161
211956430 157 P 157
62637536  157 P 157
15150589  161 P 161
21492600  161 P 161
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap