Conserved Protein Domain Family
PHA02795

?
PHA02795: PHA02795 
ankyrin-like protein; Provisional
Statistics
?
PSSM-Id: 165157
View PSSM: PHA02795
Aligned: 3 rows
Threshold Bit Score: 712.537
Threshold Setting Gi: 17974917
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17974917   1 MESADFMAVDEQFHDDLDLWSLSLVDDYKKHGLGVDCYVLEPVVDRKIFDRFLLEPICDPVDVLYDYFRIHRDNIDQYIV 80 
17975101   1 MESADFMAVDEQFHDDLDLWSLSLVDDYKKHGLGVDCYVLEPVVDRKIFDRFLLEPICDPVDVLYDYFRIHRDNIDQYIV 80 
20178385   1 MESADFMAVDEQFHDDLR--SLSLIDDYAKHGLGVDCYVLEPVVDRKIFDRFLLEPFSDPVDILYDYFRIHRDNIDQYIV 78 
17974917  81 DRLFAYITYKDIISALVSKNYMEDIFSIIIKNCNSVQDLLLYYLSNAYVEIDIVDFMVDHGAVIYKIECLNAYFRGICKK 160
17975101  81 DRLFAYITYKDIISALVSKNYMEDIFSIIIKNCNSVQDLLLYYLSNAYVEIDIVDFMVDHGAVIYKIECLNAYFRGICKK 160
20178385  79 DRLFAYITYQDIISALVSRNYTEDIFSMIIKNCNSVQDLLLCYLSNAYVEIDIVDFMVDHGAVIYKIECLNAYFGGMCKK 158
17974917 161 ESSVVEFILNCGIPDENDVKLDLYKIIQYTRGFLVDEPTVLEIYKLCIPYIEDINQLDAGGRTLLYRAIYAGYIDLVSWL 240
17975101 161 ESSVVEFILNCGIPDENDVKLDLYKIIQYTRGFLVDEPTVLEIYKLCIPYIEDINQLDAGGRTLLYRAIYAGYIDLVSWL 240
20178385 159 ESNVVEFILNCGILDENDVNVDLYKIIQYSRRFIVDEPTVLEICKLCIPYIEDINQLDAGGRTLLYRAIYAGYIDLVSWL 238
17974917 241 LENGANVNAVMSNGYTCLDVAVDRGSVIARRETHLKILEILLREPLSIDCIKLAILNNTIENHDVIKLCIKYFMMVDYSL 320
17975101 241 LENGANVNAVMSNGYTCLDVAVDRGSVIARRETHLKILEILLREPLSIDCIKLAILNNTIENHDVIKLCIKYFMMVDYSL 320
20178385 239 LENGANVNAVMSDGYTCLDVAVDRGSVIARRDIHLKILELVLREPLSIDCIKSAILNNTVENHDVIKLCIKYFMMVDYSL 318
17974917 321 CNVYASSLFDYIIDCKQELEYIRQMKIHNTTMYELIYNRDKNKHASHILHRYSKHPVLTQCITKGFKIYTEVTEQVTKAL 400
17975101 321 CNVYASSLFDYIIDCKQELEYIRQMKIHNTTMYELIYNRDKNKHASHILHRYSKHPVLTQCITKGFKIYTEVTEQVTKAL 400
20178385 319 CDVYESSLFDYIVNCKQELEYIRQMKIHNTTMYELIYNRDKNKHASHILHRYSKHPVLTQCITRGFKIYTEVNEHVAKAL 398
17974917 401 NRRALIDEIINNVSTDDNLLSKLPLEIRDLIVSQAVI 437
17975101 401 NRRALIDEIINNVSTDDNLLSKLPLEIRDLIVSQAVI 437
20178385 399 NRRALIDEIINNVSTDDNLLSKLPLEIRDLIVSQAII 435
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap