Conserved Protein Domain Family
PHA02793

?
PHA02793: PHA02793 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165156
View PSSM: PHA02793
Aligned: 2 rows
Threshold Bit Score: 78.2185
Threshold Setting Gi: 17974918
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
113195186  1 MYYANICLDFDNNVYTIKDKNYTNAVIEYPVVCNFRRYSESDsgSDVDDRTELHKHNNDSDSDDYT 66 
17974918   1 MYYANICLDFDNNVYTVKDKNYTNAVIEYPVVCNFRRYSESD--SDVDDRAELHKRNNDSDSDDYT 64 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap