Conserved Protein Domain Family
PHA02792

?
PHA02792: PHA02792 
ankyrin-like protein; Provisional
Statistics
?
PSSM-Id: 165155
View PSSM: PHA02792
Aligned: 4 rows
Threshold Bit Score: 1014.1
Threshold Setting Gi: 113195197
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66275816    1 MVN-DKILYDSCKTFNIDASSAQSLIESGANPLYEYDGETPLKAYVTKKNNNIKNDVVILLLSSVDYKNINDFDIFEYLC 79 
20178395    1 MIN-DKILYDSCKTFNIDACSAQSLIESGANPLYEYNGETPLKAYVTKKNNNIKNDVVILLLSSVDYKNINDFDIFEYVC 79 
17974925    1 MVN-DKILYDSCKTFNIDASIAQSLIESGANPLYEYDGETPLKAYVTKKNNNIKNDVVILLLSSVDYKNINDFDIFEYLC 79 
113195197   1 MVGwDSMLYDSCKTF--DACSAQSLVER---------NENSLKAYVTKKNKNIKTDVVVTLLSSTNYKNINDFDIFEYIE 69 
66275816   80 SDNIDIDLLKLLISKGIEINSIKNGINIVEKYATTSNPNVDVFKLLLDKGIPTCSNIQYGYKIKIEQIRRAgEYYNWDDE 159
20178395   80 SDNVDIELLKLLISKGLEINSIKHGINIVEKYATTSNPNVDVFKLLLDKGIPTCSNIQYGYKIKIEQIRRAgEYYNWDDE 159
17974925   80 SDNIDIDLLKLLISKGIEINSIKNGINIVEKYATTSNPNIDVFKLLLDKGIPTCSNIQYGYNIIPIQCTDY-IYFNWDDE 158
113195197  70 SDNIDVELLRLLIAKGLEINSCKNGINIVEKYATTSNPNVDVFKLLLDQGIPMCSNVSYGYKIIIEKVT------DFSSG 143
66275816  160 LDDYDY--DYTTDYDDRMGKTVLYYYIITRSQDGYATSLDVINYLISHKKEMRYYTYREHTTLYYYLDKCDIKREIFDAL 237
20178395  160 LDDYDY--DYTTDYDDRMCKTVLYYYIITRSQDGYATSLDVINYLISHEKEMRYYTYREHTTLYYYLDKCDIKREIFDAL 237
17974925  159 FDYLDY--DYTTDYDNRMGKTVLYYYIITRSQDGYVTSLDVINYLISHENEMCHYTYRERTILYYYVDKCDIKREIFDVL 236
113195197 144 YDDDDYyqDYIINIDDKIGKTALYYYIITRSRDKL--SLDVINCLISYEKEILYYTYRSYTTLHYYVGRCDVKREIFDAL 221
66275816  238 FDSNYSGHELMNILSNYLRKQFRKKNHKIDNYIVDQLLFDRDTFYILELCNSLRNNILISTILKRYTDSIQDLLLEYVSY 317
20178395  238 FDSNYSGHELMHILSNYLRKQFRNKNYKIDNYIVDKLLSEHDTFYILELCNSLRNNIIISTILKRYTDSIQDLLSEYVSY 317
17974925  237 FDSNYSGNELMHILSIYLRKQYRKKNHKIDNYIVDKLLSAHDTFYILELCNSLRNNVIISSILKRYTDSIQDLLSEYVSY 316
113195197 222 YDNNYQNNERMNILHNYLRIRYKNKN-PIDNYIIDRLLDGCGSKDILVLFNMARYNIIYTSI-KRYKYSIQDLLTRYISH 299
66275816  318 HTVYINVIKCMIDEGATLYRFKHINKYFQKFGNRDPKVVEYILKNGNLVVdnDNDDNLINIMPLFP--TFSMRELDVLSI 395
20178395  318 HTVYINVIKCMIDEGATLYRFKHINKYFQKFDNRDPKVVEYILKNGNVVV--NDNDNIINIMPLFP--TLSIRESEVLSI 393
17974925  317 HTVYINVIKCMIREGAILYRFKHINKYFKRFDNRDPKVVEYILKNGNVVV---NDDNIINIMPLFP--TLFIHESEVLSI 391
113195197 300 GIVRTNIIKCMIDEGAVLYRYKHVNEYFINIHKVDPKVVEYILKNGVDVV--EDDNNTINIMPLFPvcVHNNHDEDVLSI 377
66275816  396 LKLCKPYIDDINKIDKHGCSILYHCIKSHSVSLVEWLIDNGADINIITKYGFTCITICVILADKYIPEIAELYIKILEII 475
20178395  394 LKICKPYIDDINKIDKHGCSILYHCIESHSVSLVEWLIDNGADINITTTYGSTCIGICVIMAHACIPEIAEIYIKILEII 473
17974925  392 LKICKPYIDDINKIDKHGRSILYYCIESHSVALVEWLIDNGADINITTTYGSTCIGICVIMAHACIPEIAEIYIKILEII 471
113195197 378 LKLCKPYIDDINKIDTRGRSILYYCVYYHNTILVEWLVDNGADINIVTKCGYTCIGICIILAYGCIPEIAELYIQILECI 457
66275816  476 LSKLPTIECIKKTVDYLDDHRYLFIGGNNKSLLKICIKYFILVDYKYTCSMYPSYIEFITDCEKEIADMRQIKINGTDML 555
20178395  474 LSKLPTIECIKKTVDYLSNDRHLLIGNKTKSLLKICIKYFILVDYKYTCDTYPSYIEYITDCEKEIADMRQIKINGMDIF 553
17974925  472 LSKLPTIECIKKTVDYLSNDRHLLIGNKAKSLLKICIKYFILVDYKYICDTYPSYIEYITDCEKEIADMCQIKINGTDML 551
113195197 458 LSRLPTIECIKSTVENIKRRYYVYI--YNKSLIEMCIRYFILVDYKYTCDMYPSYIEYITECEKEITDMRQIKINGTDML 535
66275816  556 TVMYMLNKPTKKRYVNNPIFTDWANKQYKFYNQIIYNANKLIEQSKKIDDMIEEVSIDDNRLSTLPLEIRHLIFSYAFL 634
20178395  554 TIMYKLNKHTKKRYVRHPVFTEWAKRQYKFYNQIIYNANKLIEESNKIDNMIEAVSADNNRLSILPLEIRHLIFSYAFL 632
17974925  552 TVMYKLNKPTKKRYVNNPIFTDWANKQYKFYNQIIYNANRLIEQSKKIDNMIDEVSADNNRLSTLPLELRHLIFSYAFL 630
113195197 536 TVMYKLNKPTKKRYVNNPVFIEWAKQQYKFYNQIIYNANKLIEQSKKIDNMIDEVSADNNRLSTLPLELRHLIFSYAFL 614
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap