Conserved Protein Domain Family
PHA02791

?
PHA02791: PHA02791 
ankyrin-like protein; Provisional
Statistics
?
PSSM-Id: 165154
View PSSM: PHA02791
Aligned: 4 rows
Threshold Bit Score: 464.13
Threshold Setting Gi: 17974940
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66275829   1 MDLSRINTWKSKQLKSFLSSKDAFKADVHGHSALYYAIADNNVRLVCTLLNAGALKNLLENEFPLHQAATLEDTKIVKIL 80 
17974940   1 MDLSRINTWKSKQLKSFLSSKDAFKADINGHSVLYYAIADNNVRLVCTLLNAGALKNLLDNEFPLHQAATLEDTKIVKIL 80 
22164629   1 MDLSRINTWKSKQLKSFLSSKDAFKADVHGHSALYYAIADNNVRLVCTLLNTGALKNLLENEFPLHQAATLEDTKIVKIL 80 
20178409   1 MDLSRINTWKSKQLKSFLSSKDAFKADVHGHSALYYAIADNNVRLVCTLLNAGALKNLLENEFPLHQAATLEDTKIAKIL 80 
66275829  81 LFSGLDDSQFDDKGNTALYYAVDSGNMQTVKLFVKKNWRLMFYGKTGWKTSFYHAVMLNDVSIVSYFLSEIPSTFDLAIL 160
17974940  81 LFSGMDDSQFDDKGNTALYYAVDSGNMQTVKLFVKKNWRLMFYGKTGWKTSFYHAVMLNDVSIVSYFLSEIPSPFDLAIL 160
22164629  81 LFSGMDDSQFDDKGNTALYYAVDSGNMQTVKLFVKKNWRLMFYGKTGWKTSFYHTVMLNDVSIVSYFLSEIPSTFDLAIL 160
20178409  81 LFSGMDDSQFDDKGNTALYYAVDSGNMQTVKLFVKKNWRLMFYGKTGWKTSFYHAVMLNDVSIVSYFLSEIPSTFDLAIL 160
66275829 161 LSCIHITIKNGHVDMMILLLDYMTSTNTnNSLLFIPDIKLAIDNKDIEMLQALFKYDINIYSANLENVLLDDAEIAKMII 240
17974940 161 LSCIHTTIKNGHVDMMILLLDYMTSTNT-NSLLFIPDIKLAIDNKDIEMLQALFKYDINIYSVNLENVLLDDAEIAKMII 239
22164629 161 LSCIHITIKNGHVDMMILLIDYMASTNTnNSLLFIPDIKLAIDNKDLEILQALFKYDINIYSVNLENVLLDDAEITKMII 240
20178409 161 YSCIHDSIKNGNVDMMILLLDYMESTNTnNSLLFIPDIKLAIDNKDLEMLQALFKYDINIYSVNLENVLLDDAEIAKMII 240
66275829 241 EKHVEYKSDSYTKDLDIVKNNKLDEIISKNKELRLMYVNCVKKN 284
17974940 240 EKHVEYKSDSYTKDLDDVKNNKLDEIISKNEELRLMYVNYVRKN 283
22164629 241 EKHVEYKSDSYTKDLDIVKNNKLDEIISKNKELRLMYVNCVRKT 284
20178409 241 EKHVEYKSDSYTKDLDIVKNNKLDEIISKNKELRLMYVNYARKN 284
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap