Conserved Protein Domain Family
PHA02790

?
PHA02790: PHA02790 
Kelch-like protein; Provisional
Statistics
?
PSSM-Id: 165153
View PSSM: PHA02790
Aligned: 6 rows
Threshold Bit Score: 911.733
Threshold Setting Gi: 17974948
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20178417    1 MPIFVNTVYCKNILALSMTKKFKTIIEAIGGNIIVNSTILKKLSPYFRTHLRQKYTKNKDPVTRVCLDLDIHSLTSIVIY 80 
18640272    1 MPIFVNTVYCKNILALSMTKKFKTIIDAIGGNIIVNSTILKKLSPYFRTHLRQKYTKNKDQVTRVCLDLDIHSLISIVIY 80 
22164632    1 MPIFVNTVYCKNILALSMTKKFKTIIEAIGGNIIVNSTILKKLSPYFRTHLRQKYTKNKDPVTRVCLDLDIHSLTSIVIY 80 
17974948    1 MPIFVNTVYCKNILALYTTKKFKTIIEAIGGNIIVNSTILKKLSPYFRTHLRQKYTKNKDPVTRVCLDLDIHSLTSIVIY 80 
66275839    1 MPIFVNTVYCKNILALSMTKKFKTIIDAIGGNIIVNSTILKKLSPYFRTHLRQKYTKNKDPVTRVCLDLDIHSLTSIVIY 80 
113195220   1 MPIFVNTVYCKNILALSMTKKFKTIIDAIGGNIIVNSTILKKLSPYFRTHLRQKYTKNKDQVTRVCLDLDIHSLTSIVIY 80 
20178417   81 SYTGKVYIDSHNVVNLLRASILTSVEFIIYTCINFILRDFRKEYCVECYMMGIEYGLSNLLCHTKDFIAKHFLELEDDII 160
18640272   81 SYTGKVYIDRHNVINLLRASILTSVEFIIYTCINFILRDFRKEYCVECYMMGIEYGLSNLLCHTKDFISKHFLELEEDII 160
22164632   81 SYTGKVYIDSHNVVNLLRASILTSVEFIIYTCINFIIRDFRKEYCVECYMMGIEYGLSNLLCHTKDFITKHFLELEDDII 160
17974948   81 SYTGKVYIDSHNVVNLLRASILTSVEFIIYTCIYFILRDFRKEYCIVCYMMGIEYGLSNLLCHTKDFITKLFLELEDDII 160
66275839   81 SYTGKVYIDSHNVVNLLRASILTSVEFIIYTCINFILRDFRKEYCVECYMMGIEYGLSNLLCHTKNFIAKHFLELEDDII 160
113195220  81 SYTGKVYIDRHNVINLLRASILTSVEFIIYTCINFILRDFRKEYCVECYMMGIEYGLSNLLCHTKDFIAKHFLELEEDII 160
20178417  161 DNFDYLSMKLILESDELNVPDEDYVVDFVIKWYMKRRNRLGNLLLLIKNVIRSNYLSPRGINNVKWILDCTKIFHCDKRP 240
18640272  161 DNFDYLSMKLILESDELNVPDEDYVVDFVIKWYMKRRNRLGNLLLLIKNVIRSNYLSPRGINNVKWILDCTKIFHCDKQP 240
22164632  161 DNFDYLSMKLILESNELNVPDEDYVVDFVIKWYMKRRNRLGNLLLLIKNVIRSNYLSPRGINNVKWILDCTKIFHCDKQP 240
17974948  161 DNFDYLSMKLILESDELNVPDEDYVVDFVIKWYMRRRNRLGNLLLLIKNVIRSNYLSPRGIHNVKWILDCNKIFHCDKQP 240
66275839  161 DNFDYLSMKLILESDELNVPDEDYVVDFVIKWYIKRRNKLGNLLLLIKNVIRSNYLSPRGINNVKWILDCTKIFHCDKQP 240
113195220 161 DNFDYLSMKLILESDELNVPDEDYVVDFVIKWYMKRRNRLGNLLLLIKNVIRSNYLSPRGINNVKWILDCTKIFHCDKQP 240
20178417  241 RKSYRYPFIEYPMNMDQIIDIFHMCTSTHVGEVVYLIGGWMNNEIHNHAIALNCVSNNWIPIPPMNSPRLYASGVPANNK 320
18640272  241 RKSYRYPFIEYPMNMDQIIDIFHMCTSTHVGEVVYLIGGWMNNEIHNNAIAVNYISNNWIPIPPMNSPRLYASGVPANNK 320
22164632  241 RKSYKYPFIEYHMNMDQIIDIFHMCTSTHVGEVVYLIGGWMNNEIHNNAIALNCTSNNWIPIPPMNSPRLYASGVAANNK 320
17974948  241 RKSYKYPFIEYPMNMDQIIDIFHMCTSTHVGEVVYLIGGWMNNEIHNNAIAVNYISNNWIPIPPMNSPRLYASGIPANNK 320
66275839  241 RKSYKYPFIEYPMNMDQIIDIFHMCTSTHVGEVVYLIGGWMNNEIHNNAIAVNYISNNWIPIPPMNSPRLYASGIPANNK 320
113195220 241 RKSYRYPFIEYPMNMDQIIDIFHMCTSTHVGEVVYLIGGWMNNEIHNNAIAVNYISNNWIPIPPMNSPRLYASGIPANNK 320
20178417  321 LYVVGGLPNPTSVERWFHGDTSWVNMPSLLKPRCNPAIASINNVIYVIGGHSETDTTTEYLLPDHDQWQFGPSTYYPHYK 400
18640272  321 LYVVGGLPNPTSVERWFHGDAAWVNMPSLLKPRCNPAVASINNVIYVIGGHSETDTTTEYLLPNHDQWQFGPSTYYPHYK 400
22164632  321 LYVVGGLPNPTSVECWFHGDTSWVNMPSLLKPRYNPAIASINNVIYVIGGHSETDTTTEYLLPNHNQWQFGPSTYYPHYK 400
17974948  321 LYVVGGLPNPTSVERWFHGDAAWVNMPSLLKPRCNPAVASINNVIYVMGGHSETDTTTEYLLPNHDQWQFGPSTYYPHYK 400
66275839  321 LYVVGGLPNPTSVERWFHGDAAWVNMPSLLKPRCNPAVASINNVIYVMGGHSETDTTTEYLLPNHDQWQFGPSTYYPHYK 400
113195220 321 LYVVGGLPNPTSVERWFHGDAAWVNMPSLLKPRCNPAVAPINNVIYVIGGHSETDTTTEYLLPNHDQWQFGPSTYYPHYK 400
20178417  401 SCALVFGRRLFLVGRNAEFYCEYSNTWNLIDDPIYPRDNPELIIVDNKLLLIGGFYRGSYIDTIEVYNNRTYSWNIWDGK 480
18640272  401 SCALVFGRRLFLVGRNAEFYCEYSNTWSLIDDPIYPRDNPELIIVDNKLLLIGGFYRGSYIDTIEVYNHRTYSWNIWDGK 480
22164632  401 SCALVFGRRLFLVGRNAEFYCGSSNTWTLIDDPIYPRDNPELIIVDNKLLLIGGFYRGSYIDTIEVYNNRTYSWNIWNGI 480
17974948  401 SCALVFGRRLFLVGRNAEFYCESSNTWTLIDDPIYPRDNPELIIVDNKLLLIGGFYRGSYIDTIEVYNNRTYSWNIWNGM 480
66275839  401 SCALVFGRRLFLVGRNAEFYCESSNTWTLIDDPIYPRDNPELIIVDNKLLLIGGFYRESYIDTIEVYNHHTYSWNIWDGK 480
113195220 401 SCALVFGRRLFLVGRNAEFYCEYSNTWSLIDDPIYPRDNPELIIVDNKLLLIGGFYRGSYIDTIEVYNHRTYSWNIWDGK 480
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap