Conserved Protein Domain Family
PHA02789

?
PHA02789: PHA02789 
uncharacterized protein; Provisional
Statistics
?
PSSM-Id: 165152
View PSSM: PHA02789
Aligned: 2 rows
Threshold Bit Score: 323.478
Threshold Setting Gi: 17975100
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17975100   3 SRIAIYVLVSASLLYLVNCHKLVHYFNLKINGSDITNTADILLDNYPIMTFDGKDIYPSIAFMVGNKLFLDLYKNIFVEF 82 
20178386   1 MHLQYYAISLVSLVSLIDCHKLAFNFNLEINGSDTHSTVDVYLDDSQIITFDGKDIRPTIPFMIGDEIFLPFYKNVFSEF 80 
17975100  83 FRLF-RVSVSSQYEELEYYYSCDYTNNRPTIKQHYFYNGEEYTEidRSKKATNKNSWLITSGFRLQKWFDSEDCIIYLRS 161
20178386  81 FSLFrRVPTSTPYEDLTYFYECDYTDNKSTFDQFYLYNGEEYTV--KTQEATNKNMWLTTSEFRLKKWFDGEDCIMHLRS 158
17975100 162 LVRRMEDSNKNSK 174
20178386 159 LVRKMEDSKRNTG 171
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap