Conserved Protein Domain Family
PHA02785

?
PHA02785: PHA02785 
IL-beta-binding protein; Provisional
Statistics
?
PSSM-Id: 165149
View PSSM: PHA02785
Aligned: 5 rows
Threshold Bit Score: 634.747
Threshold Setting Gi: 22164598
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
113195380   1 MSILPIIFLPIFFYSSFVTTFNTPECIDKGQYFASFMELENEPVILPCPQINTLSSGYNILDILWEKRGADNDRIIPIDN 80 
66275994    1 MSILPVIFLSIFFYSSFVQTFNAPECIDKGQYFASFMELENEPVILPCPQINTLSSGYNILDILWEKRGADNDRIIPIDN 80 
20178569    1 MSIPPVIFLPIFFYSSFVQAFNAPECIDKGQYFASFMELENEPVILPCPQINTISSGYNILDILWEKRGADNDRIIPIDN 80 
22164598    1 MSALLTILLPIFFYSSFIHTFNNIECIDNGLYFTSFMELEKEPVILPCPQINTLSSGYNVLDIIWEKRGADNDNIIPIDN 80 
17975088    1 MSILPVIFLPIFFYSPFVQTFNVPECIDKGQYFASFMELENEPVILPCPQINTLSSGYNILDILWEKRGADNDRIIQIDN 80 
113195380  81 GNNMLILNPTQSDSGIYMCITKNETYCDMMSLNLTIVSVSESNIDLISYPQIVNERSTGEMVCPNINAFIASN--VNADI 158
66275994   81 GSNMLILNPTQSDSGIYICITTNETYCDMMSLNLTIVSVSESNIDLISYPQIVNERSTGEMVCPNINAFIASN--VNADI 158
20178569   81 GSNMLILNPTQSDSGIYICITKNETYCDMMSLNLTIVSVSESNIDLISYTQIVNERTTGEMVCPNINAFIASN--VNADI 158
22164598   81 GTNMLILNPTQTDSGIYICITKNETYCDMMSLNLTIVTDTESNIDLISYPQIVNERSTGEMVCPNINAFIARNkdVDVDV 160
17975088   81 GSNMLILNPTQSDSGIYICITTNETYCDMMSLNLTIVSVSESNIDLISYPQIVNERSTGEMVCPNINAFISSN--VNADI 158
113195380 159 IWSGHRRLRNKRLKQRTPGIITIEDVRKNDAGYYTCVLKYIYGSKAYNVTRIVKLEVRDRIIPPTMQLPEGIVISLGSNL 238
66275994  159 IWSGHRRLRNKRLKQRTPGIITIEDVRKNDAGYYTCVLEYIYGGKTYNVTRIVKLEVRDKIIPSTMQLPDGIVTSIGSNL 238
20178569  159 IWSGHRRLRNKRLRQRTPGIITIEDVRKNDAGYYTCVLKYTYGDKTYDVTRIVKLEVRDRMIPPTMQLPDGVVTSIGSNL 238
22164598  161 IWRGHPRLRNKRLTQRPIGIITIEDVRKNDAGYYTCVLKYTYRDKTYEVTRIVKLEVRDRIIPPTMQLPVVVMTSLGSNL 240
17975088  159 IWSGHRRLRNKRLKQRTPGIITIEDVRKNDAGYYTCVLEYIYMGKTYNVTRIIKLEVRDRIIPPTMKLPEGVVTSIGSNL 238
113195380 239 TIACRVSLRPPTTDADVFWISNGMYYEEDDEDGDGRISVANKIYTTDKRRVITSRLNINPVKEEDATTFTCMTFTIP-SI 317
66275994  239 TIACRVSLRPPTTDADVFWISNGMYYEEDDGDGNGRISVANKIYMTDKRRVITSRLNINPVKEEDATTFTCMAFTIP-SI 317
20178569  239 TIACRVSLRPPTTDADVFWISNGMYYEEDDEDGDGRISVANKIYTTDKRRVITSRLKINPVKEEDATTFTCMAFTIP-SI 317
22164598  241 TIACRVSLRPPTIDADVFWISNNEYYEEDDEDSDGR-SVTNRIFTIDKRRVITSRLNINPVKEDDATTFTCMAFTVHnSI 319
17975088  239 TITCRVSLRLPTTDADVFWISNGMYYEEEDEDGDGRISVANKIYMTDKRRVITSWLNINPVKEEDATTFTCMAFTIP-SI 317
113195380 318 SKTVTISII 326
66275994  318 SKTVTVSIT 326
20178569  318 SKTVTISIT 326
22164598  320 SKTVTISIK 328
17975088  318 SKTVTVSIT 326
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap