Conserved Protein Domain Family
PHA02783

?
PHA02783: PHA02783 
uncharacterized protein; Provisional
Statistics
?
PSSM-Id: 165148
Aligned: 5 rows
Threshold Bit Score: 290.736
Threshold Setting Gi: 20178561
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17975082    1 MYKKLITFLFVIGAVASYSNNEYTPFNKLSVKLYIDGVDNIENSYTdDNNELVLNFKEYTISIITESCDVGFDSIDIDVI 80 
22164592    1 MYKKLITFLFVIGAVASYSNNEYTPFNKLSVKLYIDGVDNIENSYT-DNNELVLNFKEYTISIITESCDVGFDSIDIDVI 79 
20178561    1 MYKKLITFLFVIGAIASYSNNEYTPFNKLSVKLYIDGVDNIENSYT-DNNELVLNFKEYTVSIITESCDIGFDSIDIDVI 79 
66275986    1 MYKKLITFLFVIGALASYSNNEYTPFNKLSVKLYIDGVDNIENSYTdDNNELVLNFKEYTISIITESCDVGFDSIDIDVI 80 
113195367   1 MYKKLITFLFVIGAIASYSNNEYTPFNKLSVKLYINGVDNIENSYT-DNNELVLIFKEYTVSIITESCDVGFDSIDIDVI 79 
22164592    1 MYKKLITFLFVIGAVASYSNNEYTPFNKLSVKLYIDGVDNIENSYT-DNNELVLNFKEYTISIITESCDVGFDSIDIDVI 79 
20178561    1 MYKKLITFLFVIGAIASYSNNEYTPFNKLSVKLYIDGVDNIENSYT-DNNELVLNFKEYTVSIITESCDIGFDSIDIDVI 79 
66275986    1 MYKKLITFLFVIGALASYSNNEYTPFNKLSVKLYIDGVDNIENSYTdDNNELVLNFKEYTISIITESCDVGFDSIDIDVI 80 
113195367   1 MYKKLITFLFVIGAIASYSNNEYTPFNKLSVKLYINGVDNIENSYT-DNNELVLIFKEYTVSIITESCDVGFDSIDIDVI 79 
17975082   81 NDYKIIDMYTIDSSTIQRREHTCRISTKLSCYYDKYPYIHKYEGDERQYSITAEGKCYKGIKYEISMMNDDTLLRKHTLK 160
22164592   80 NDYKILDMYTIDSSTIQRRGHTCKISTKLSCHYDKHPYIHKYEGDERQYSITAEGKCYKGIKYEISMMHDDTLLRKHTLK 159
20178561   80 DDYKILDMYTIGSSTIQRRGHTCRISTKLSCHYDKHPYIHKYEGDERQYSITAEGKCYKGIKYEISMMNDDILLRQHTLK 159
66275986   81 NDYKIIDMYTIDSSTIQRRGHTCRISTKLSCHYDKYPYIHKYDGDERQYSITAEGKCYKGIKYEISMINDDTLLRKHTLK 160
113195367  80 NDYKIIDMYTIDSSTIQRRGHTCRISTKLSCHYDKHPYIHKYEGDERQYSITAEGKCYKGIKYEISMMNDDILLRQHTLK 159
22164592   80 NDYKILDMYTIDSSTIQRRGHTCKISTKLSCHYDKHPYIHKYEGDERQYSITAEGKCYKGIKYEISMMHDDTLLRKHTLK 159
20178561   80 DDYKILDMYTIGSSTIQRRGHTCRISTKLSCHYDKHPYIHKYEGDERQYSITAEGKCYKGIKYEISMMNDDILLRQHTLK 159
66275986   81 NDYKIIDMYTIDSSTIQRRGHTCRISTKLSCHYDKYPYIHKYDGDERQYSITAEGKCYKGIKYEISMINDDTLLRKHTLK 160
113195367  80 NDYKIIDMYTIDSSTIQRRGHTCRISTKLSCHYDKHPYIHKYEGDERQYSITAEGKCYKGIKYEISMMNDDILLRQHTLK 159
17975082  161 IGFTYIFDRHGHSNTYYSKYDF 182
22164592  160 IGSTYIFDRHGHSNTYYSKYDF 181
20178561  160 IGSTNIFDRHEHSNIYYPKYDL 181
66275986  161 IGSTYIFDRHGHSNTYYSKYDF 182
113195367 160 IGSTNIFDSHGHSNTYYSKYDL 181
22164592  160 IGSTYIFDRHGHSNTYYSKYDF 181
20178561  160 IGSTNIFDRHEHSNIYYPKYDL 181
66275986  161 IGSTYIFDRHGHSNTYYSKYDF 182
113195367 160 IGSTNIFDSHGHSNTYYSKYDL 181
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap