Conserved Protein Domain Family
PHA02782

?
PHA02782: PHA02782 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165147
View PSSM: PHA02782
Aligned: 5 rows
Threshold Bit Score: 1095.48
Threshold Setting Gi: 18640413
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20178557    1 MAMFYAHAFGGYDENLHAFPGISSTVANDVRKYSVVSVYNNKYDIVKDKYMWCYSYVNKRYIGALLPMFECNEYLQIGDP 80 
113195363   1 MAMFYAHALGGYDENLHAFPGISSTVANDVRKYSVVSVYNNKYDIVKDKYMWCYSQVNKRYIGALMPMFECNEYLQIGDP 80 
18640413    1 MAMFYAHALGGYDENIHAFPGISSTVANDVRKYSVVSVYNNKYDIIKDKYMWCYSQVNKRYIGALLPMFECNEYLQIGDP 80 
22164759    1 MAMFYTHAFGGYDENLHAFPGISSTVANDVRKYSVVSVYNKKYKIVKNKYMWCYSQVNKRYIGALLPMFECNEYLQIGDP 80 
17975078    1 --MFYAHAFGGYDENLHAFPRISSTVANDVRKYSVVSVYNKKYNIVKNKYMWCNSQVNKRYIGALLPMFECNEYLQIGDP 78 
20178557   81 IHDLEGNQISIVTYRHKNYYALSGIGYESLDLCLEGVGIHHHTLEAGNAVYGKVQHDYSTIKEKAKEMNSLSPGPIIDYH 160
113195363  81 IHDQEGNQISIVTYRHKNYYALSGIGYESLDLCLEGVGIHHHVLETGNAVYGKVQHDYSTIKEKAKEMSALSPGPIIDYH 160
18640413   81 IHDQEGNQISIVTYRHKNYYALSGIGYESLDLCLEGVGIHHHVLETGNAVYGKVQHDYSTIKEKAKEMSTLSPGPIIDYH 160
22164759   81 IHDQEGNQISIITYRHKNYYALSGIGYESLDLCLEGVGIHHHVLETGNAVYGKVQHDYSTIKEKAKEMSALSPGPIIDYH 160
17975078   79 IHDLEGNQISIVTYRHKNYYALSGIGYESLDLCLEGVGIHHHVLETGNAVYGKVQHEYSTIKEKAKEMNALKPGPIIDYH 158
20178557  161 VWIGDCVCQVTAVDVHGKEIMRMRFKKGAVLPIPNLVKVKLGeENDTVNLSTSISALLNSGGGTIEVTSKEERVDYVLMK 240
113195363 161 VWIGDCICQVTAVDVHGKEIMRMRFKKGAVLQIPNLVKVKLG-ENDTENLSTTISALLNSGGGTIEVTSQEDRVNHVLMK 239
18640413  161 VWIGDCICQVTAVDVHGKEIMRMRFKKGAVLQIPNLVKVKLG-ENDSENLSTTISALLNSGGGTIEVTSQEDRVNHVLMK 239
22164759  161 VWIGDCICQVTAVDVHGKEIMRMRFKKGAVLQIPNLVKVKLG-ENDTENLSTAISALLNSGGGTIEVTSKEERVDYVLMK 239
17975078  159 VWIGDCVCQVTTVDVHGKEIMRMRFKRGAVLPIPNLVKVKVGeENDTINLSTSISALLNSGGGTIEVTSKEERVDYVLMK 238
20178557  241 RLESIRHLWSvVYDHFDVVNGKERCYVHMHSSNQSPMLSTVKTNLYMKTMGACLQMDYMEALEYLSELKESGGRSPRPEL 320
113195363 240 RLESIRHMWS-VYDRFNIVNGKECCYIHLHSSNQNLMPSTVKTNLYMRSMTSCIQMDPITALDYLSELKESGGQSPRPEL 318
18640413  240 RLESIRHMWS-VYDRFNIVNGKECCYIHLHSSNQNLMPSTVKTNLYMRSMTSCIQMDPITALYYLSELKESGGQSPRPEL 318
22164759  240 RLESIHHLWSvVYDHLNVVNGKERCYVHMHSSNQHPIPSTVKTNLYMKTMGSCLQMDSMEALEYLSELKESGGRSPRPEL 319
17975078  239 RLESIHHLWSvVYDHLNVVNGEERCYIHMHSSHQSPMLSTVKTNLYMKTMGACLQMDSMEALEYLSELKESGGRSPRPEL 318
20178557  321 PEFEYPDGVEDAGSIERLAEEFFSRSELQADEPVNFCNSINVKHTSVSAKQLRTRIRQQLPSILSSFANTDGGYLFIGVD 400
113195363 319 PEFDYPDGVQDDGSIERFAEEFFNRSELQAGESVEFGNSVNVKNTSVSAKQLRTRIRQQLPSILSSFANTEGGYLFIGLD 398
18640413  319 PEFDYPDGVQDDGSIERVAEEFFNRSELQAGESVEFGNSVNVKNTSVSAKQLRTRIRQQLPSILSSFANTEGGYLFIGLD 398
22164759  320 QKFEYPDGVEDTESIERLAEEFFNRSELQAGESVKFGNSINVKHTSVSAKQLRTRIRQQLPSILSSFANTEGGYLFIGVD 399
17975078  319 QKFEYPDGVKDTESIERLAEEFFNRSELQAGESVKFGNSINVKHTSVSAKQLRTRIRQQLPSILSSFANTKGGYLFIGVD 398
20178557  401 NNTHKVVGFTVGQDYLKLVESDIEKYIKRLRVVHFCEKKEDIKYACRFIKVYKPGEETTSTYVCAIKVERCCCAVFADWP 480
113195363 399 NITHKVIGFTVGQDCLKLIENEIEKRIRRLHVVHFCEKKEDIKYACRFIKVYKPGEETTSTYVCAIKVERCCCAVFTNWP 478
18640413  399 NNTHKVIGFTVGQDCLKLIENEIEKRIRRLHVVHFCEKKEDIKYACRFIKVYKPGEETTSTYVCAIKVERCCCAVFTDWP 478
22164759  400 NNTHKVIGFTVGHDYLRLVENDIEKHIKRLRVVHFCEKKEDIKYACRFIKVYKPGDETTSTYMCAIKVERCCCAVFADWP 479
17975078  399 NNTHKVIGFTVGHDYLKLVERDIEKYIQKLPVVHFCKKKEDIKYACRFIKVYKPGDETTSTYVCAIKVERCCCAVFADWP 478
20178557  481 ESWYMDTSGsMKKYSPDEWVSHIKF 505
113195363 479 ESWYMDTSG-IKKYSPDEWVSSIKF 502
18640413  479 ESWYMDTSG-IKKYSPDEWVSSIKF 502
22164759  480 ESWYMDTNG-IKKYSPDEWVSYIKV 503
17975078  479 ESWYMDTSGsMKKYSPDEWVSHIKF 503
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap