Conserved Protein Domain Family
PHA02781

?
PHA02781: PHA02781 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165146
View PSSM: PHA02781
Aligned: 5 rows
Threshold Bit Score: 76.2319
Threshold Setting Gi: 17975067
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66275966   5 MDKIKITVDSKIGNVVTISYNLEKITIDVTPKKKKEKDVLLAQSVAVEEAKDVKVEEKNIIDIEDDDDMDVESA 78 
17975067   1 MDKIKITIDSKIGNVVTISYNLEKITIDVTPKKKKEKDVLLAQSVAVEEAKDVKVEEKNIIDIEDDDDMDIENT 74 
20178542   5 MDKIKITVDSKIGNVVTISYNLEKITIDVTPKKKKEKEVLV-QVINADEAKDVKEEEKNIIDITDDDGMDVESS 77 
18640397   5 MDKIKITVDSKISNVVTISYNLEKITIDVTPKKKKEKDVLLAQSVAVEEAKDVKVEEKNIIDIEDDDDMDVESA 78 
113195345  5 MDKIKITVDSKIGNVVTISYNLEKITIDVTPKKKKEKDVLLAQSVAVEEAKDVKVEEKNIIDIEDDDDMDVESA 78 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap