Conserved Protein Domain Family
PHA02780

?
PHA02780: PHA02780 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177490
View PSSM: PHA02780
Aligned: 4 rows
Threshold Bit Score: 90.8815
Threshold Setting Gi: 17974959
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20178428  1 MKHRVYSEELGINTDLNSIISQQSTMDMDMEIDEDEIMELLNILTELGCDVDFDENFSDIADDILESLIEQDV 73 
17974959  1 MKHRLYSEGLSISNDLNSIIGQQSTMDTDIEIDEDDIMELLNILTELGCDVDFDENFSDIADDILESLIEQDI 73 
66275850  1 MKHRLYSEGLSISNDLNSIIGQQSTMDTDIEIDEDDIMELLNILTELGCDVDFDENFSDIADDILESLIEQDV 73 
22164642  1 MKHRVYSEGLDISTDLNSIISQPSAL--DMYMDEDEIVELLNILTELGCDVDFDENFSDIADDILESLVEQDV 71 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap