Conserved Protein Domain Family
PHA02777

?
PHA02777: PHA02777 
major capsid L1 protein; Provisional
Statistics
?
PSSM-Id: 165142
View PSSM: PHA02777
Aligned: 2 rows
Threshold Bit Score: 788.071
Threshold Setting Gi: 62362152
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9626048    1 MLARQRVKRANPEQLYKTCKATgGDCPPDVIKRYEQTTPADSILKYGSVGVFFGGLGIGTGRGGGGTVLGAGAVG-GRPS 79 
62362152   1 MVVRRRIKRANPTQLYATCKIT-GTCPPDIINKIEGNTVADKILKWGSTGVYLGGLGIGTGRGGGGVSLGGGSIGsARPS 79 
9626048   80 ISSGAIGPRDILPIESGGPSLAEEIPLLPMAPRVPRPTDPFRPSVLEEPF--IIRPPERPNILHeqrfptdaAPFDNGNT 157
62362152  80 VPAGSIGPGDIITVDAEAGAVQPPVEPPPTTSISGSARRPFGEGFGRQPLdpIGIPRPRPSLPR--------PTLDTVPT 151
9626048  158 EITTIPSQYDVSGGGVDIQIIELPSvNDPGPSVVTRTQYNNPTFEVEVSTDI-SGETSSTDNIIVGAESGGTSVGDNAEL 236
62362152 152 DVAVLEGPHTPFGAGGDIAVLEVPT-PEVGRSVTARTQYNNPAFEVSIHSELpSAETSSVDHVYVGTPSSGSFVGQDVQF 230
9626048  237 -IPLLDISRG---DTIDTTILAPGEEETAFVTSTPERV-PIQERL-PIRPYGRQYQQVRVTDPEFLDSAAVLVSLENPVF 310
62362152 231 eLPVLQAEYAildGQAETSFIEHGSYSEVPLTSTPDPVlPTTEAIaSIRPYGRQFGQVRVGDAAFLSRPAVLFQAENPAY 310
9626048  311 DADITLTFEDDLQQALRSDTDLRDVRRLSRPYYQRRTTGLRVSRLGQRRGTISTRSGVQVGSAAHFFQDISpigqAIEPI 390
62362152 311 DPDVSILFERDVADLERLPDPFQDIQYLSRPYYQRRATGLRLSRIGRREGIIQTRSGTRVGSSHHFFYDIS----DITPL 386
9626048  391 DAIELDVLGEQSgegtivrgdptpsieqdIGLTALGDNIENELQEIDLLTADGEEDQEGRDLQLVF---STGNDEVVDIM 467
62362152 387 EEIEMDSIGEHS-----------------LGVSTAAEQPIEVYSEADLLDEMEEGDTLARSSQLLLsfaSVGEEGEDITI 449
9626048  468 TIPIRAGGDDRPSVFIFSDDGTHIVYpTSTTATTPLVPAQPSDVpyiVVDLYSGSMDYDIHPSLLRRKRKKRKRV 542
62362152 450 QLPIDLLSIEKPSTAFYPDTGVNIAY-TPTKITTPSLPWVPIDD---TLDTFQNYNDYDLHPSLLPRRKRKRRIL 520
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap