Conserved Protein Domain Family
PHA02775

?
PHA02775: PHA02775 
E6; Provisional
Statistics
?
PSSM-Id: 165140
View PSSM: PHA02775
Aligned: 2 rows
Threshold Bit Score: 247.998
Threshold Setting Gi: 9626042
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62362147   1 MAKASQQKKAVCMAQERdhgtpllPRTLRELCVWRGQEFPNVSVTCKYCKKCLSLLDVYLFDQTVLNVLWSDGTPAAVCT 80 
9626042    4 TSGVGSVGPASCCETQK-------PHTIRELCLAQQITYPCIQLCCHYCYKILSVLDIYAFDQSCLYLSWGEGGPTGICS 76 
62362147  81 LCLRLLARLEFRARHMFSCTVQHIPLLLYRPFVTCTVRCVRCLMPLTTVEKEFLARQHTVVHFVGRSLRTLCTHCTAGLF 160
9626042   77 QCTRVLARLEFTARHEVSCAASRLPHFIGQSLSDLEVRCVRCLALLQSVEKDYILREDLSVHRIGGIWRGTCVRCMVGLY 156
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap