Conserved Protein Domain Family
PHA02773

?
PHA02773: PHA02773 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165138
View PSSM: PHA02773
Aligned: 2 rows
Threshold Bit Score: 164.345
Threshold Setting Gi: 22122320
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122266   1 MSLYIYDIKVKEMSQEVQIKLYPKQKELLIRFFSLAQKDSDNDLCIPMYTSEGKLFLFQKDANRYQYFGYLRIKRLVDKN 80 
22122320   1 MSFYIMYIKVKEMSEQKQISLRSKQKELLQRFFEIAEVDENGDLCIPLYDSSGDLTLFKQDSRKYQMYAYFRILRLIKKQ 80 
22122266  81 IFFIKIKRVKRDKKFLCIKEDIVDYVRLLLES 112
22122320  81 IFFIKVKKVKRDKKFLCMHSNVIDQVKSVLES 112
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap