Conserved Protein Domain Family
PHA02772

?
PHA02772: PHA02772 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165137
View PSSM: PHA02772
Aligned: 2 rows
Threshold Bit Score: 153.221
Threshold Setting Gi: 22122319
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122319  1 MNLKKVKRIIDMFFKEKNLDELTLAFKRPLIITENEYNELVKRPNLSFEDKDPWVTSDEFVYYELSNRVVKLIIHYFKED 80 
22122265  1 MNLKKVKRIIDMFFKEKNLNELTLAFKRPLIVSENEYNELVGRPNLSFVDKDPWVLSDEFVYYELSNTLVKLIIYYFKEK 80 
22122319 81 DIINILEIDLFREKR 95 
22122265 81 GFIHILEIDLFREKR 95 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap