Conserved Protein Domain Family
PHA02771

?
PHA02771: PHA02771 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165136
View PSSM: PHA02771
Aligned: 2 rows
Threshold Bit Score: 151.295
Threshold Setting Gi: 22122318
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122264  1 MEFEELKSIVEKFFQDQTIVRMNLMLNKEIIVSYNQFEEIIKDGDLTYRYAEKNRTVDFYEYRNNIHSIINYFWKDNKVC 80 
22122318  5 MEFEELKSIIDKFFQDSTIIRINLRFNKEVIVSYNQFEELIRNGDLTHRYADKNITSDIYEYRENINSIIDYYWKDNKIC 84 
22122264 81 IIEIDFWRSR 90 
22122318 85 ILEIDFWRSS 94 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap