Conserved Protein Domain Family
PHA02770

?
PHA02770: PHA02770 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165135
View PSSM: PHA02770
Aligned: 2 rows
Threshold Bit Score: 138.982
Threshold Setting Gi: 22122240
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122293  4 MSQIEEVVKTLNKKDIKDIITKNISFLVEPQILFYAKKRNRVTGYLEVNGRHYRFELIFSKDNSVSITVGELIVFGNGDL 83 
22122240  1 MSSQEEIIKTLNKKDIKDIITKNISFLVEPQILFYAKKRNRIVGYLEVNGRHYRFELIFSKDNSVSITIGELVVFGSSDL 80 
22122293 84 K 84 
22122240 81 K 81 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap