Conserved Protein Domain Family
PHA02769

?
PHA02769: PHA02769 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165134
View PSSM: PHA02769
Aligned: 2 rows
Threshold Bit Score: 293.452
Threshold Setting Gi: 22122253
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122253   1 MNQKYEVEEIKNKELVKLARMLIDYYHIQGMVKGGGAGRNSRYFMYLEKEDDKKYIVAVAWLHDNTPFRFIAQQYNIPND 80 
22122307   1 MNPKYEIEEVKNKELIKLARMLIDYYHVQGMVKGGGAGRNSRYFIYLQKEDDKEYIVAVAWLHDNTPFRFIAQQYNIPND 80 
22122253  81 RSYFIRRVTKTAPGDHLVNFLNDLAEKLKKDGFEVLWTLGFPDHSNALYKKAGFKLVGQTSRTKHEVYVKYLNK 154
22122307  81 RSYFIRRITKTAPGDHLVNFLTDLAEKLKNDGFEVLWTLGFPEHSNALYKKAGFKLVGQTSRTKHEVYVKYLNK 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap