Conserved Protein Domain Family
PHA02767

?
PHA02767: PHA02767 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165132
View PSSM: PHA02767
Aligned: 2 rows
Threshold Bit Score: 164.413
Threshold Setting Gi: 22122297
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122245   1 MEIDIKNECRKYIIQFRNWLESRYSDNIYFFNVFEDEEIILMQIKINMKKKEYEKAGMSMLKYLVRTFKYPNYIKVNWRY 80 
22122297   1 MEIDLKNECRKYIIQFRNWLESRYSENIYFFNVFEDEEIILIQIKMNMKKKEYEKIGMSILKYLVHTFKYPNYIKVNWRY 80 
22122245  81 DKNMFKISAICGDINMSESNN 101
22122297  81 DRNMFKISVLCGNINMSETEN 101
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap