Conserved Protein Domain Family
PHA02766

?
PHA02766: PHA02766 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165131
View PSSM: PHA02766
Aligned: 2 rows
Threshold Bit Score: 112.454
Threshold Setting Gi: 22122270
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122270  3 LFFEDSIIQELSLKFKISFEINEEEYQQLIELAFSQFIYPSNDNIEIKINTKELADNEKALLYEIQLWRTKKS 75 
22122323  1 MFFEDSNIQELSLKFKISFEINEEDYRQLVELALSQFIYPLNDNIEIRINTKELADNEKDLLYEIQILRTKKL 73 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap