Conserved Protein Domain Family
PHA02765

?
PHA02765: PHA02765 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165130
View PSSM: PHA02765
Aligned: 2 rows
Threshold Bit Score: 163.329
Threshold Setting Gi: 22122236
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122289   3 LKKVLNFHFSYIYTYFVTITTNYKYGDTEKIFKKFRQYIYNHDKNSHVFSIKETTKNSNGLHYHILVFTNKKLDYSRVHK 82 
22122236   1 MKKVLNFHFSYIYTYFITITTNYKYGDTEKIFRKFRSYIYNHDKNSHVFSIKETTKNSNGLHYHILVFTNKKLDYSRVHK 80 
22122289  83 HMPPHSDIRIELVPKNMSDIKNVYKYMLKTKKDIKMS 119
22122236  81 HMPSHSDIRIELVPKSISDIKNVYKYMLKTKKDIKMS 117
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap