Conserved Protein Domain Family
PHA02764

?
PHA02764: PHA02764 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165129
View PSSM: PHA02764
Aligned: 2 rows
Threshold Bit Score: 531.064
Threshold Setting Gi: 22122234
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122234   1 MELERKSSGIIKSFNVLDIFSINLLYMGILSGISYPLFVSSLMKNVNLLFAIVIGAVFEIPLLLMYYKLTTKFPLNGGDY 80 
22122287   1 MEFERKSSGIIKSFNILDIFSINLLYMGILSGISYPLFVSSLLKNVNLLYAILIGAVFEIPLLLMYYRLTTKYPLNGGDY 80 
22122234  81 AYIRTAFSSKFYTIFGISLWLTYVLSQPILGDLVLLNFNIQNQFEQFLIVESLFPLVLLIIASKRIYAKIVDILAIFQII 160
22122287  81 AYIRTAFSSKFYTVFGISLWLTYVLSQPILGDLVLLNFNIQNQFEQFLIVESLFPIVLLIIANKKIYAKIVDILAIAQII 160
22122234 161 IAIFIAFKSFNYQYQTFTISNTLLSALLFDLSAFIFINAISYIAGEIKNIKKSSMIGYFVSYGVVAILSILDSYSNLNIL 240
22122287 161 IAIFIAFKSFSFQYQNFTISNTLLSALLFDLSAFIFINAISYIAGEIKNIKKSSMVGYFVSYGIVAILSIIDSYSNLNIL 240
22122234 241 FALMPIWFFSYMPIANKIQSRLIQTMSFDKVLPEKFSKINPNVLLLIFSTETIANVLENLLGFNISFGLDGLLFIFWNFI 320
22122287 241 FALMPIWFFSYMPIANKIQSRLIQTMSFDKVLPEKFSKINPNVLLLIFIANTIANVLENLLGFNISFGLDGLLFIFWNFI 320
22122234 321 IVAFAYLKLMNDKKLFSIVLTSLAIQIFLFFYLGYQNPIFYKFVIAGNIEYTILRIMILPIIGAIVYLLRKSKINVIPK 399
22122287 321 IVAFAYLKLMNDRILFFTVLTSLAIQIFLFFYLGYQNIIFYKFVISGNIEYTILRIIIIPIIGAIVYLLRKSKINVMPK 399
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap