Conserved Protein Domain Family
PHA02763

?
PHA02763: PHA02763 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177487
View PSSM: PHA02763
Aligned: 3 rows
Threshold Bit Score: 170.442
Threshold Setting Gi: 270281796
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
270281796   1 MIFNSKVVRNYILNGAKVVATIRKRSFYKIGQKVVINVGDRKFPGKVIAIAPITLDSLSKYVDYSGFNSVEEWLYEARRL 80 
22122285    1 MIFNSPIVQKYILNNAKAVATIRKKFVYKIGQKVILKVRDKRFHGKIIAKAPVTEYCLSKYVKFSGFENVESWLNEAERL 80 
22122232    4 MIFNSLIVQKYILNNAKAVATIRKKGYYKLYQKIILKVGDKRFYGKVIAKAPVTEYCLSKYVKFSGFENVENWLNEAKRL 83 
270281796  81 HGTGIDPYRYEIIVVEVtrevtrNGRLF 108
22122285   81 HNDKIDSEKYEIIVIWI------TNLYF 102
22122232   84 HNDKIDFERYEIIVIWI------NDSFF 105
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap