Conserved Protein Domain Family
PHA02762

?
PHA02762: PHA02762 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165127
View PSSM: PHA02762
Aligned: 2 rows
Threshold Bit Score: 95.7806
Threshold Setting Gi: 22122231
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122231 15 LKILIDNEFSNLIIEFKRNVKKSFEGEAFVTIGIDENDKISYISIEPLDKDLKEGIKRIKVL 76 
22122284  1 MKILVDNDFGNLIIEFKRNVEKSFEGEAFVTIGVDKNGRISYISIEPLDKDLKEGIKRIKVL 62 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap