Conserved Protein Domain Family
PHA02759

?
PHA02759: PHA02759 
virus coat protein VP2; Provisional
Statistics
?
PSSM-Id: 165126
View PSSM: PHA02759
Aligned: 2 rows
Threshold Bit Score: 235.61
Threshold Setting Gi: 47131175
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
47131175   1 MLLPEGAG-LLGLLAIALLNRKAIPIALITLFVSAAVAVAGGAVYAAFTPLMAGAIALYALRQEE-RVIEKVVGLFLGLS 78 
56693017   1 MIIPFSLGaLAGLLIIAFFARRQIIFALVAIFISGALAGVAGSIYYSFMAMYLAALTIYIIVQEEgRIVERALALYLGTL 80 
47131175  79 IIWASDNTAIAQVFATISYEIVKPFFDALVNVMgvIGFGGVLGALLAWSLLSPRLISIAEKEPLVSMGYVLLGAVVLAGA 158
56693017  81 AIWLSDNSAAASALSLIAYQLVMPLFQAINNVF--VQAGIAFSGLLAWSIVARRIMTVAEEFPLIGAGYVYLAYSILAPM 158
47131175 159 VAAVPPYVALAMAIALLNQFSRALRGNMEALGEIAPALFILAtlIPPTTLAPLGAVLAVIELAFGVLSRRHLAGAAMWAT 238
56693017 159 VMTLPDYLKLALGLALIGPFSQAVKGDLEALEEIAPFLWLLP--IPIDTVKVIGAAVAIIELALGVLSKKRLLASAMWAE 236
47131175 239 AAMLV 243
56693017 237 AILLA 241
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap