Conserved Protein Domain Family
PHA02756

?
PHA02756: PHA02756 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165123
View PSSM: PHA02756
Aligned: 2 rows
Threshold Bit Score: 240.992
Threshold Setting Gi: 56693012
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
47131180   1 MTALRKAIVLIYLAFLGFSWLQLVWFFGYPSVGGFILTPSAHPYIPPLSLLIVKPSNECNGWAVKLFEINWMGL-KLYLP 79 
56693012   2 AEALKKLLIIFYLIILGFSWLQLPWFFGITSVGGLVLTPSSYPYIPPLSLIVTVPTNTCEGWSVYFVNGTWLGLfEIHVP 81 
47131180  80 VVHYFAKvgpvTYEYFNYYV-ITNNVWDNVVNYFHRIIDPKWVGXQYNGPCVAEVVAVIPAPLVILIMAiALTTAIYYGA 158
56693012  82 VVHYFSG----RYEIFNMRAsFGSSVLDNIKHYIEALIWPEMAAVPYNHSCAARVIFIIPSPIVLISFA-ALGYHIYYRF 156
47131180 159 KRVW 162
56693012 157 RRVW 160
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap