Conserved Protein Domain Family
PHA02755

?
PHA02755: PHA02755 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165122
View PSSM: PHA02755
Aligned: 2 rows
Threshold Bit Score: 175.985
Threshold Setting Gi: 56693013
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
47131181  1 MSYNISGGMAIGSYPDAVQGTPFVEAAEEKYKMRYALGVCTALREADPKGFEETFGageAGLRNCALKAGAYADRNFDIW 80 
56693013  4 QFRPMYPGVQVGSYPDTVQGSPAAERAEEVYKVKYAVGICQALKEYDPQAFQEYFG---GDMQKCVRAAGSFADLNFDTW 80 
47131181 81 KVKWPTALRAQIATFG 96 
56693013 81 KIKWGRNLGAQISAFA 96 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap