Conserved Protein Domain Family
PHA02754

?
PHA02754: PHA02754 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165121
View PSSM: PHA02754
Aligned: 2 rows
Threshold Bit Score: 80.8074
Threshold Setting Gi: 56693016
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
56693016  1 MSKAEEIRKLITEKRFSEAMRQVKDILSSRGVYVHRISVVYVSGNkIVVITADGIKIVVTETEVIIA 67 
47131184  3 FVTASELPQALMNKDFKRFMRELRDRLSEAGIYIDRIKAITTSGD-IVVVYSDAIVVELSWTNKSVI 68 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap