Conserved Protein Domain Family
PHA02753

?
PHA02753: PHA02753 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165120
View PSSM: PHA02753
Aligned: 2 rows
Threshold Bit Score: 267.176
Threshold Setting Gi: 56693018
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
47131172   1 MSAIAEtIGKYGILGLLAAFVPAFVHGAMAGAVGLSgNPAIATIQIIAYMAIVAYWARHSVVDGLLAGIGLGAGVVAVSQ 80 
56693018   1 MSYIPD-LSRFGVLGILALFVPSFVYGAMTMYLGVA-NGWLFLIQLLALIAIIAHYKNFSEAVLFALGAAFGGLTTQFIG 78 
47131172  81 AHDLAIQGILFGIGTLInTIVDYIISGFLMGLGYGFLMGISPTAILagLAGFLFGVVVMLLVRVGNLLTEALELGITALf 160
56693018  79 IKWLVVDALSPALYVLL-SMVNTIEKAFYLGIALGMVGFLLAPIVF--IVTTLVSLAAMLILRLSGLLYEAVNLVVHGL- 154
47131172 161 KNLSVGYAALIAPFVGGIFVGVPLGVMLLVFGFALAMGLGFVVGLAIASLLFMFGLVWAFIGFILNIGLlvaalvifkTF 240
56693018 155 RHVPEGYRALLAPWIGSVMIALPIAVLGGMFLSALALVVGAVVGGALVGMLGTASEVSALAGFIIPTLL---------TR 225
47131172 241 TKSTDVIQILLDLAVIFIFKF-----IGPALYAAGYAGLVTRHRVRALYFIALGALGS 293
56693018 226 PQTKTIAEVLMDMGALFLGVMlvgygVVQVLWTAGYAAISTRHASRGFYLIGLSAITA 283
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap