Conserved Protein Domain Family
PHA02752

?
PHA02752: PHA02752 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177486
View PSSM: PHA02752
Aligned: 2 rows
Threshold Bit Score: 261.178
Threshold Setting Gi: 56693024
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
47131171  21 AVLILALLIGYAIYASFNRGTSGGGGGSNTTTTITGTSAPSNV--LYPNAALANGFDLILVED-HVNVNSGQYSIVASAV 97 
56693024   1 MAAALAIIAILAIAAFLLMGASKGGGIPTQQPTTTTTSPPPAYtdVYPTVSPPNSVSGIYIDSgRFTCDGTTCTLTVSGY 80 
47131171  98 GSYRSIVAYGGSSV-SGNITNGIAVIKYGGYEIPVVGFASTNSSIVQD-------FPGIQVrlstsgGYVLYTPLSMAIY 169
56693024  81 GTFVSIVAYSARPLsSANATVGPAYITVGNYRIWLFGYIATSLANYSDtafsvyvFPALKC------GYIYYPKVGASIA 154
47131171 170 YRHLqyniSNTVVHVWVPSKTqPATLASASLHVVIDPEYGTYYINGVAYGLDMDTPPRQYRGVLRSWLVYTTAGGSYVFT 249
56693024 155 LAVF----NDTNYWVVVPTNS-PGTCALPGHIITVDNTNAVAFVDGTSTTISIGTLPKSVSGVAYAYMVSISQSGRYAIQ 229
47131171 250 IN 251
56693024 230 FS 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap