Conserved Protein Domain Family
PHA02751

?
PHA02751: PHA02751 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165118
View PSSM: PHA02751
Aligned: 2 rows
Threshold Bit Score: 350.531
Threshold Setting Gi: 56693005
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
47131170   1 MPKIKIIDRMSGKTWDADVDTEKLCLSSTWSTMFGV-GQKCLPMTPDRFSQVMKYVKPGFGSVYVEALVLPDTLRVFVAD 79 
56693005   2 TTRLKLXDMVQRKIFTANLNPDKICVSSQIYEWLGLpSTKCVPITPTTQAEIMRVAVPMADGLYAMAYIVPDTIRLIHSY 81 
47131170  80 LVVISPRGVDITEMFYDLRLGEVGIIFGNAFMPVRiNWENAKCE-----GRTCVIFGALVRDDGVLRHVPIIYEKEYLEW 154
56693005  82 LFTFSFAETKVFEVLYDARLGAYGVVMQNKFMPLS-SLEPFVCDnvvglTRLCYIIGDVVTVNGHAKVVGYTTPEIYRMW 160
47131170 155 LRAMLSKRPAESweVIMQRLQIYESTLNRLLEELSKLADRSayelavmviqqarnimsqvQALTQQPRGGGQA 227
56693005 161 VRGVAERNLSDS--VLTIPLRVHRELVTEYETMLASCVNKS-------------------RRYMQIPRLCLRA 212
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap