Conserved Protein Domain Family
PHA02750

?
PHA02750: PHA02750 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165117
View PSSM: PHA02750
Aligned: 2 rows
Threshold Bit Score: 299.85
Threshold Setting Gi: 56693019
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
47131166  17 DTPEELAFETESAIEEIESetspgdqpkgsepeeIRVWAEEkarkaveegrevtnwadwiMGWRTPNASEKKMEFMYWYT 96 
56693019   1 MDSLEMDAEYEWDLDEINS---------------LEFWLDA-------------------ISFVLPHIEDLPLEQQIEYV 46 
47131166  97 RTYLEEAKDIRpdiadALARGMAGLAFGRTDWVASM--------LDPQIMRHIYT---DPEVARIYSETRDML------- 158
56693019  47 RTWGQTVAKAR-----AMRVGEGGYNKEAVDFMADMvvagkfgvVGPNITRELYEyvrTFGVDQFLFEARDVLkaaypqi 121
47131166 159 RRVSDYYISLTTmelGKVADIIAEAkAKGENPEVVAREIAEAVPRLSPKSLYFNLYYIGRSIGDNYVLEVARVLSKMRRR 238
56693019 122 RRASQYYLSIPA---DAYIDIVSYA-AQGKYDDIRRYAEMLIEEGRSPRSVYFNLYYIARATGDREIYGIAREIERLSRK 197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap