Conserved Protein Domain Family
PHA02749

?
PHA02749: PHA02749 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165116
View PSSM: PHA02749
Aligned: 2 rows
Threshold Bit Score: 390.862
Threshold Setting Gi: 56693001
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
56693001   1 MD-LKILNAVVAGLTIA--MFFVNNPYLNIAIWIAIMVTTAYATEITLSLYRVTIWFNVLVVSALIALPQAIMAIKLMAD 77 
47131158   1 MDfVRLVTATVYAYFIVssIFGVTNIWVDIALYLILLVSVVYATEVNMALSNARVWYNVMVVSVAMALPQTVFAVNLAVS 80 
56693001  78 GHILAAWIDTIASTIVDSIIVTAFTRRDIIGSDYIWKG--VHYLILWSVAALSVNLLTYL--ISAGFQLPLhliagaYIA 153
47131158  81 GKPLAAWIDTLGSTLVDAIFVTAVVRRHVVGSPLVRSPlvVFFLFAWSILAVGLNIMAWHpeLYTSTHFPL------FYA 154
56693001 154 IGYLVLPTIIVltyRTEAGMIPPKSVIVTTLFNTISMXISSYFLTDSLYQIHLAEQTLGITSTFLASVPDLLTAFIIRAL 233
47131158 155 IAGLLLPIILV---RGNVHGLPSGRDMLMLTNNAFATLVASYMLSEAVAQLHIEEVQLGVVSTVLATLPDFIVGMLIRSV 231
56693001 234 FAMXVGXEAGDVEAMATMFASAVHDQVSVPAVMLYMMPAAALMYPHPLNIYAVIAKFTLLNKKLYYFVGLPLSVALLILL 313
47131158 232 VSEILSSQAGDQEMVFTMLAAAVHDQLTIPGLIMLLAPYAMGYYPHLFNIVVVLLKFTLLDRRLFWFVGVPGGLLALVAP 311
56693001 314 AA 315
47131158 312 PV 313
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap