Conserved Protein Domain Family
PHA02748

?
PHA02748: PHA02748 
viral inexin-like protein; Provisional
Statistics
?
PSSM-Id: 165115
View PSSM: PHA02748
Aligned: 13 rows
Threshold Bit Score: 518.029
Threshold Setting Gi: 124484663
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124484623   1 MSVALKALRGLLKVQAVNIDTNVFRLHYKLTVIVLLVLWLLITSRQFFGNYMECYFPDYPTISLNTYCYIHSTFLVKPSE 80 
124484626  16 MVDTSSFLRGLLKVQSIATDENFNRLHYKITATILLFFSLLISWAHFSGDAVDCDFPGRSHRSLDTYCYAHSTFLVERFI 95 
124484627   4 LVDLKSLLCGLFEVQTITIDNMLFRLHYRVTVTILAIFTLFTALRQLFMDPIDCDFVGLSRPFHNTYCYIHPTFLVERML 83 
124484796   1 MLNLMRALRGLVKPQSVHIDNIFFYVHYKLTVMFLIAFSVLVASRQYFGDPIDCEFPEYPNGELNNYCYVQATFVRERAG 80 
124484797   1 MLHLLKALRGLLKPRSVQLHNTVFCLHYKFTVTFLIAFSIVGASQQYFGETIDCQFAEYKNGELNNYCSAQDTFVREQTA 80 
124484794   1 MLHLMSALRGLVKPRSTHIDNIFFCFHYKFTVLFLLAFSILVASRQYFGEPIECEFDEYENGKLNNYCFVKATFVREQNT 80 
124484617   1 MLPVLSSLRGLLKIQSTSIDSNVDRLHYKVTVIVLLAFSILITSGQFFGEPMDCDFPDYRYHSLNTYCYIHSTFLGKQAL 80 
124484691   2 LDAFFDSLRGLLALDGTAIDTTFFRLHYKSTVGLLLIFSLLSHSREYFGEPLDCHFTENSLGSLNKYCAVQSTFVIEPSV 81 
124484663   1 MTGVFGAIFGRLSLQSVITDSAFFWLNYRITVIILVALAWLMIVQEIFQDPIECIFADYSEVYINRYCSLQSFFTLRRKV 80 
124484667   1 MPDVFGAIFGRCSRQSVITDSVFFRLNYRITVILLVASALAVIVQEIFHDPMECIFADYPEIGSSSYCSFQSVFSLKRKV 80 
124484634   1 MRNLINAVKGLIKLPTVSIDNVFFRLHYQFTVIILIAFSLLVTSRQYFGKLIDCHFPDYPYGSLNDFCSVQPTYLEVIGT 80 
94675983    1 MLKIFRTLRGLLKVHVISIDNNFFILHYKITVVILLALAMLVTSQQFFKNPMECNFSDLPLGS-SHYCYVHATFLEQQQI 79 
94675984    1 MFNILSSLRGLLKVHSISIDNDFFRLHYKLTAVILLAFSMVVTSVQFFRDPMDCYFPDFPHGSLNTYCYVHSTFLTKHQS 80 
124484623  81 KNPARQSLP--HPGVSGQREGDTLKFYSYYQWLFVVLFVQAVFFYLPHHVWKVWEGGLMKTLAVDLTSPVVSADRIKKNT 158
124484626  96 TGTEREYVP--HPGVAAHVKDDKLKFYGYYGWVYIVLFLQALSFYIPHYMWKSWEGGKLKMLTVELTSPVLRKDCIKENT 173
124484627  84 TDELNKTVP--FPGFSGDTAEDKLKVYSYYQWISIVLVLKATLLYIPHYIWKCWEGGKIQSLAGELDVAVLSEDTLNRRV 161
124484796  81 TRGGNRVTF--DPEVSRQTEEEHVRYCRYYSWVFIALFVQAVFFYIPRYMWKAWEGGRVKLLAAEINSPILSQDRIKKET 158
124484797  81 N----------DGEGEEDTKGNRVRYYTYYSWVSLTLFLQAVFFYTPHYIWKVWEGGRLQALTSKIIFPILDKDAVEKGV 150
124484794  81 -----------KDAEVGGKPTETVRYYGYYSWVFLTLFLQAVFFYVPHYLWKAWESGRVKALSHEIGCLTLDEDVVVKEA 149
124484617  81 NDRGDERVPt-HLGSPGFTAEDQKNYYGYYEWVFIVLFLQAVSYYIPRFIWKSWEGGRIQMLAGGLADPVLSKDCIRENT 159
124484691  82 KAKNSSTTVk-DMMHPAPDESREKRYYSYYQWVSVALLIQALFFYAPWYIWETLDKGRMATLIADMAAPILRKDVIIEKT 160
124484663  81 TLLMEDGF---SVEDSAVQADLSLTMINYYQIGFITLLLRAVLFYIPRYLWNLMEGGKMKMLATELITSNGGKDCSEKNN 157
124484667  81 IVTEQVS----DVEGSAAPDDMRTRTYTHYQLGFITLLLQAVLFCIPRCLWNLMEGGKMKLMATELITSTEGKACREKDI 156
124484634  81 THDVISPIS--PHQVRTSNQQREIKYYGYYQWVFIVLFIQAVFFSIPQYIWKVCEGGKMKTLAHDLTSPFLSKECITEKV 158
94675983   80 THHVPPQRLp-GGNISGETGEKEFRFYNYYEWVYLTLAVQAILFYVPHYIWKAWEGGKMKMLAVEFASPVLSEDFIENKM 158
94675984   81 IRQVLSRRLplPGGISTDAEEDELKFYDYYEWIFLSLTLQAILFYIPHYIWKAWEGGRIKMLAEELAPPVLTKDRIENNI 160
124484623 159 DVLLEYFQTQLHSHNSYALKYFSCELFNLINIISQILFMNAFLGEDFHYYGIYVLIVHWKEGLqpEMTKPMELLFPTVTK 238
124484626 174 EPLIDYFCSTLHSHNSYAYKYFFCEMLNFINAVGQICFMNVFIGEDFVYYGIDIIMFNREQIV--GMTDPMERLFPVMTK 251
124484627 162 TSLVDYLFSQLHSHNRYAYQYMTCELLNVITIVAQIWLMNVFIGKDFHLYGIEVIAFNQQQGKe-SRLNPMERLFPTITM 240
124484796 159 ERLSQYFTMHLHTHNFYAYRYFFCELLNLINIECQIIFLNQFIGEGFQSYGIDVIFSKDE-----DKYNGIGELFPISTI 233
124484797 151 EGLSEYFFKNRKTHNAYAYKHLICELLNLINIAGQIVFMNRFIGDGYQFYGIHVLLMNRE-----DMEKRIGQLFPTRTI 225
124484794 150 QRLSKYFFNNLHTHNGYFYKYFVCELLNMINIVGQIFFMNRFIGEGFQFYGIYILSMNHD-----DVEKLIGQLFPMKTI 224
124484617 160 KPLVDYFSMRLHSHNAYAAKYFIYETLYLANTVIQIFGMNRFFGEDFQYYGLNVAFHQQFGG---NMVNPMEKVFPTITQ 236
124484691 161 QSLLDYVIMNMHKHNFYAYSYFACELLSLLNVVGHIILMNIFLGEGLQLYGAFVTAFNDRANE--DARDPMETVFPSVTK 238
124484663 158 QPLIFYFRKHFHGHDNYAYHYMFCESLNLFNLGVQLQLSRIFIDNRFGIFDIYPILAGQPT----SVTDTSGQLLSITTE 233
124484667 157 QPLTLYFHDNLHKHNNYAMYYMVCEVLNLFNLGVQLQLMAICTGKPFDLSNVFAMFTGQLA----GVTDISGKPLSITTE 232
124484634 159 DHLMDYFFMQLHAQNSYAYKYFGCELLNFVNVVAQICFMNAFIGEDFLLYGIYVTFFNQEAAHp-NMTNPMKRVFPTITR 237
94675983  159 IPVVEYFCTTLHSHNAYAYKYFTCEFLNLVNVVGQILFLKIFLGEEFASFGIDVITFDHRQEK--SMKNPIDRLFPIVTR 236
94675984  161 GPLVDYFCTTLHSHNIYFYKYFTCELLNLVNVVGQIAFMNAFLGEDFSLYGIDVMMFNQSLNK--SKGNPVELLFPTMTK 238
124484623 239 CTFK-KYGPSGSAELRDGMCILTQNALNQKIFVFLWFWFHILAAMSAFVIVCRIFTLVFPSLRLRSFRSTCSLNSARDIN 317
124484626 252 CTYQ-TFGPSGTLENLEGMCTLTQNALNARIYAFLWFWFYILAIISAFVVICRVVILISRSIRLYVFQTSSSLNSGGDID 330
124484627 241 CTYK-KNVTNGIVENINGICLLTQNSANQKMFVFLWFWYHILATIGVFYTIFRITTLFSSSLRYYEFRSNSKKNIPYDID 319
124484796 234 CTFE-KYSLTGIKEKLEGICLLTHNPLNEKIYGFLWFWMYSVAVISILATVYRGITLFSSSFRLHVFQFMTTMNRADDVR 312
124484797 226 CTFE-KYGLTGLREKSEGICILTHNPLNEKIYCFLWFWMHFVAVVSVLDMIYRIVTILYPPLRFYLLRFTSCGENADEIR 304
124484794 225 CTYE-KYSLTGRNDILEGICLLTHNPLNEKIYGFLWFWMHFVALMTLLSLLYRIATLSSSSYRLHILRLFSHIDDADMTQ 303
124484617 237 CIYE-RYGPSGTMESRDGICVMAQNSVNSKIYVFLWFWFHILALLSALQIIYRIVLALAPPLRLWCFRSSSALNNAQEVD 315
124484691 239 CTFR-KYDGSGDLQTFNGFCILTQNSGNAKIYTFLWLWFHLVAVISVITVTYRMAVVFVPSFRLYMFRWSSPLNTSRDIE 317
124484663 234 CTLAgPFDGPGNPGNITGTCLLSPNSVNEQIQASLFFWTYFLAVYGIFVILYRFATCLFSSVRWLKFRLSCSIIPDKTIA 313
124484667 233 CTYAgPFDGSGNPGNITGICQLARNSYNEQIQVFLWLWMYLLNVFGIFTILYHFATYLSSSLRWLQFRLPFCTIPEKSQA 312
124484634 238 CTFH-KYGPSGSLENYEGLCILPENVVNEKIYIFLWFWFYVLAIISGIVVLYRIALLASPALRLYMFRKTCLMNFPDDVQ 316
94675983  237 CSYH-KYGPSGKVENWEGLCLLPENSLNGKIYIFMWFWFHMLTAISSVVVIYRIVTLCSPSVRLYRFKPLSGLIRSEDIA 315
94675984  239 CLYR-QYSPTGTPETRDGICVLPQNSINGKIYVVLWFWFRILAVISAIMVVYRLVTLVSSSIRFYRFRSISSMSRAKDIT 317
124484623 318 VVFDKLWIGDWF-------LLCMLQRNINILAYKELIIRIARSCDSNICSEC 362
124484626 331 VVFHKLRIGDWF-------LLHMLQQNINPLAYKQLICGIAQHCDDSGVLDA 375
124484627 320 VVYQNLWIGDWF-------LLKMLRMNLNTLAYKELISLMAQRFGCCVCSVG 364
124484796 313 AAFNKLQIGDWF-------ILILLQKNVNQEVYMNLISELAQSPSKVTEV-- 355
124484797 305 AVYEKLQFGEWF-------LLLLLHENVNSQVYEALISRLAQHFKPYVVDC- 348
124484794 304 AAYKKLQIGDWF-------LLLLLEKNVNAQVFKALLLRLASYPDVSDW--- 345
124484617 316 AVFRKLWIGDWF-------LLHMLQQNMNPLAYKELISQIAEHDDDTGEKNV 360
124484691 318 IVYRELCYGDWF-------VLRLVGITVNPIIYKTLISELASRLKVGELDA- 361
124484663 314 VAYNRLKIGDWF-------VLLMLRKNIDVLHYEELILDIAANDESCV---- 354
124484667 313 VVYDRLEIEDWF-------VLMMLRKNIHREPYEELVSQLAVIYRLHVQDSA 357
124484634 317 LVHEQLQIGDWL-------LVHGLWKNTNPMIYKELITRIAHRIRFDV---- 357
94675983  316 IVFPKLNVGIGFccvgcngISTRLHTKRSFLALQSTLARPLQMLKVIADVKL 367
94675984  318 TVFNHLKIGDWF-------LLHMLHRNMNFLAYKELISRLAQHFEPSIMESD 362
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap