Conserved Protein Domain Family
PHA02747

?
PHA02747: PHA02747 
protein tyrosine phosphatase; Provisional
Statistics
?
PSSM-Id: 165114
View PSSM: PHA02747
Aligned: 2 rows
Threshold Bit Score: 538.819
Threshold Setting Gi: 66391248
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66391248   1 MVVNCFETCRAIDFWNRRNQLNFPGIVRLEHHQVILKPFNGTWENSEKPENQRKNRY-NIRCWDHNRVILKSGSGstSNY 79 
57753406   1 MDSRCFAEVSAKDFLKRRTQLNCFKLIRDEYYSIVTQPIDKLIASFMKPENQPKNRYwDIPCWEHSRVVLDTKGG--SDY 78 
66391248  80 IHANYVDGFEDDKKFIITQGPMEETCNDFWKAVWQNNCSIIVMLTPTKgTNGEELCYQYWSLNEDSNIITEDFVIETVNT 159
57753406  79 IHANWIDGFEEPKKFIATQGPFANTTADFWRLVWQEHCYVIVMLTPTK-VSGEEKCYQYWCPSENGSLDMNGFRIKTLKV 157
66391248 160 SVRPTYILTTLRITDKISNDSRRISHYQYTEWPVDETPTNHVDFIKFIKIININRKKSGSNY--QQQLLSPIVVHCSDGV 237
57753406 158 TVRAKYVRTLIEITNKSLKTSRKLSHFQCSNWFEYNTPSDLPWFVQFINMIDRVRQVYMKLFnpKDALLCPVVVHCSTGV 237
66391248 238 KKTGIFCAVDISLNQLVLRKTVSLAKTAEKIRQQRHSTISTPDDYLILqpgYYVLLYLLYKILAIIKIKNCG 309
57753406 238 GRTGTFCAVDICLNQLVKTSAICVPQVVFNVREQRYAGVMNFNQYSFI---YEVLHYFLSVQKNVDKPSFIG 306
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap