Conserved Protein Domain Family
PHA02746

?
PHA02746: PHA02746 
protein tyrosine phosphatase; Provisional
Statistics
?
PSSM-Id: 165113
View PSSM: PHA02746
Aligned: 2 rows
Threshold Bit Score: 621.663
Threshold Setting Gi: 57659588
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
57659588   1 MKDLCFKTLSASELLEMTNHPKFCRLVLQEHTEVMEIPLRGTTSQSLRKENSKKNRFSNIPCWDHSRVVINARESlTSFD 80 
66391224   1 MPGYCFEIFNVFDFFDKTNKANFWEFVRLEHAQVMDIPISGTVNHFLKPENLRKNRYHDVTCWDNSRVVLSSHGS-KMYD 79 
57659588  81 VGDWDPSRQEVTSEDNAENYIHANYVDGFKEVNKYICAQTPLEDTWESFFKLIWEQESQVIVSLTDIDRDHEKSFYLWTT 160
66391224  80 YGDSDGKKIIVTSQDSDSTYIHASFVNGFKEANKFICCQGPKESTSGDFWKMVSEHNSSVIVSLTETDDEDQVCYEYWVK 159
57659588 161 PKGSETTFGSFVAKILDVREELSFTKTRVMITNKITETSREITNFWFTDWPDNSIPTGMEEFVELRNKVNEEQARLIKQA 240
66391224 160 EEDYELAFGRYVVKTLEIIEESSFTRTRLRLTDVSSDTSREIHHFWYPHWSDYGNPTNPAEILNLISKVNQKRKEMKKTA 239
57659588 241 ENDSqtlGPIVVHCSTGTGWAGTFCAINNSLEQLEKEKEVSVGEIVLKIRSQRHSSVFLPEQYAFCYLVLKYVILEEAKN 320
66391224 240 DSQP---GPIVVHCSAGIGRTGTFCTIDNALSQLRKEQTVCLPQTVLKIRKQRHSSVFLPEQYAFCYKAVRYALIREIKK 316
57659588 321 LSS 323
66391224 317 KFF 319
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap