Conserved Protein Domain Family
PHA02744

?
PHA02744: PHA02744 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165111
View PSSM: PHA02744
Aligned: 2 rows
Threshold Bit Score: 184.067
Threshold Setting Gi: 66391239
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
57753387   1 MFIDGKYHYICVAPKEWNIYKRKDLEKMMLDSCLDHRKKTTCIHGANTQISSVSTKLEYNDLRLWLKRTDDISARPNSGS 80 
66391239  23 MILNGKYHYICIAPREWEEYSSKNLKQLIVDSCKSHRQQTTCIHGAVTNIAGVSTKLEYYDLKLWMKKQGDNSAYPDQKD 102
57753387  81 YFPMLLHI 88 
66391239 103 YFRMLLDL 110
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap