Conserved Protein Domain Family
PHA02742

?
PHA02742: PHA02742 
protein tyrosine phosphatase; Provisional
Statistics
?
PSSM-Id: 165109
View PSSM: PHA02742
Aligned: 2 rows
Threshold Bit Score: 571.561
Threshold Setting Gi: 66391233
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66391233   1 MGSHCSKNRS-CRNYVTPTQKSNVREILKREHEHIMQGIVAFSCNISLENKNMKKNRYPDAPCFDYNRVVLPIRKGLDDY 79 
57753435   1 MGAKLTKKNSfAKNCEQLIEESRLAHILKEEHHQIVQENVPYSCYEVLKLKNWSKCRYWNTSIFDRNRVILKTEDGGSDF 80 
66391233  80 INASYVDGHNMKRRFICTQGPLEETALDFWQAVYQDRVRVIVMITKTYEDNKQKCYPYWMTHERSTVTYGELKIRTKKIK 159
57753435  81 INASYVDGHNAKGRFICTQAPLEETANDFWQMIFSHQVRVIVMLTRIMEKGREACYPYWNPKKRGKAVHGKFTIKTLKIK 160
66391233 160 SFRNYKVTTLCLTNtNTGTVLDIKHFAYEDWPQGGVPSDVNNFLDFVLAVRHADSKTEVPISSESRvkeSPILVHSSAGL 239
57753435 161 SFRYYAVTNLQVTD-NTGASLDVQHFAYTDWPHNSLPRNPSKFLDFVLAVREAQLTADVDNKGKNI---PPIVVHCSAGL 236
66391233 240 DRAPAFCVIDICISKYSESAIIPLLTTVRDLRRQRNNCLSLSTQYIFCYFTVLQF--VMSTPC 300
57753435 237 NRTGAFCAIDVSLSLYNERATISLSSIVRNLRKQRHNCLSLPQYYVFCYLIVLIYakLVADKY 299
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap