Conserved Protein Domain Family
PHA02740

?
PHA02740: PHA02740 
protein tyrosine phosphatase; Provisional
Statistics
?
PSSM-Id: 165107
View PSSM: PHA02740
Aligned: 2 rows
Threshold Bit Score: 549.184
Threshold Setting Gi: 57659396
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66391231   1 MPIEDK-RMRIMDFINFVRKPDSLSCIIQEYRAIVPEQEDGASKSCNQAVNRAQDEnNALPIVRLVHSRVNLFSKEKVMS 79 
57659396   1 MAVNSAvDINGNDFLSFINKPDLLTRIIKEYYALVPKHKEEGNSASAQNENKCKKE-LGMHLTRYLNRRIKLRNDGRVLD 79 
66391231  80 ARYVDGYNHKQKFIITINSCENNTDKYLQMLWDNNVQIVVTTSSHAEKNNFnRFWSLNERTVITYNNFQIETLEIITKPH 159
57659396  80 ASFVDGYDFERKYICIKRLQEDACDKFWQAVSNYKVQIIVLISRLSDKKCY-QYWSSKEGCVKVSDKFRIKTLKIIIKPH 158
66391231 160 FVLTLLVLTDQKGQARKLSHFQYTAWPADGFSHDPKAFLDFFFNIDSLYADLRKHKTIGNVGPITIDCIDNNSSSEVFCV 239
57659396 159 FNLTLLSLTDKFGQEQKISHYQYTAWPGDNFSHKPDAFIDFYCNVKDMCLQLERQTADKKIAPIIVQCLDGISSSAVFCV 238
66391231 240 LDICLTEVKKTGMLSIANAVKKVRQKKYGCMNRLNDYVFCYHLIHAYLSMTFDIVKVR 297
57659396 239 FDICATQFDKTGTLSLPSVLKKVRQQKYGFMNCLDDYVLCYQLLAVYVKEKLFMLPFI 296
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap