Conserved Protein Domain Family
PHA02736

?
PHA02736: PHA02736 
Viral ankyrin protein; Provisional
Statistics
?
PSSM-Id: 165103
View PSSM: PHA02736
Aligned: 4 rows
Threshold Bit Score: 285.617
Threshold Setting Gi: 66391253
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
57659288   1 MWPSENFIFPGEHSREGENILHYLCRNGGVVDLLNYKNAIIDENRYLVTEYNSQGQQCIHIVAREDKIDPRKKCRRLMEW 80 
66391206   1 MWSLQDSIFTCERNHEGENIIHYLCRNGGVIDLLTFRNAINDENRYLLSEYNRDGKXCMHIVVSQDKVDPINKLMLLMKW 80 
66391209   1 MVPPEEIASASNPDIEGENILHFLCREGDITDLMAFKNVISDANRHLALQFNRHGKQCVHIVSNPGIADPQEKLKLLMEW 80 
66391253   1 MVPPEEIASASNPDIEGENILHFLCREGDITDLMAFKNVISDANRHLVLQFNRHGKQCVHIVSNPGIADPQEKLKLLMEW 80 
57659288  81 GADINAKESINGDTPLHITVKTKNYELAEWLCRQPQVNIEALNYAQQTPYHLAYKCNDAKMMTILQETAAQRKN 154
66391206  81 GADINSKDQKDGNTVLHIAVLTNNYEVAKWLCQQPGVDMEIINFARKTPYQIACDRANTRMMDLLXKNGARCDV 154
66391209  81 GADINGQERVFGNTPLHIAAYTQNHKLATWLCNQPGINMGIYNYLFKTPYYVACERHDLKIMNILRAKGTRCGV 154
66391253  81 GADINGQERVFGNTPLHIAAYTQNHKLATWLCNQPGINMGISNYLFKTPYYVACERHDIKIMNILRAKGGQCRI 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap