Conserved Protein Domain Family
PHA02735

?
PHA02735: PHA02735 
putative DNA polymerase type B; Provisional
Statistics
?
PSSM-Id: 165102
View PSSM: PHA02735
Aligned: 2 rows
Threshold Bit Score: 1283.51
Threshold Setting Gi: 90403523
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
90403482   1 MAKCDKSLEAIDLDRAYTAPRKAKWAENKRINGLDTETSDGDIFCISVCWEGEKPMVQHNDREKLTSKQVWQVLTDHKAR 80 
90403523   1 MAKSDRNLDEVNLYPAYQDQYSATFVDGKLINAFDTETSSGTVFMLTSAYGDKTQAYYNRDVSELDAETIMDALTDYKTR 80 
90403482  81 SSLNMWYNLDFDANVVLNHVCSEEQLAELVVSGttlansdrtyrqymDTDKELRKGEYLITYIQSKFLEIKDHNSHIYTH 160
90403523  81 SNINIWYNLDFDANAILSGILSQKEMSELVVTN--------------ETTTTVAGIEYEIFYIKGKMLRIVDENGNISPH 146
90403482 161 YDASQFFYTSLENAVTEWLGESKaNDGLEAGLFgsqtpnqlretvaesdcvtwtnlsltynvskgdkwtihNAKSYISKN 240
90403523 147 YDIAQFFYTSLDNAAEEWLGENK-KEGIDTSKF--------------------------------------DDKEYIKDN 187
90403482 241 WSDILKYAQIDAELVRDLWQEAVNVGEELDIPMGRPFSTGYLAESYLDNRLREKPGLGPMPMAKMAWESYAGGRFEVLKR 320
90403523 188 FDEILKYAKKDASLTQDLAIELTNEAENLDIPMGRPISTGYLSAEYLRANTEEKPSLGNEAMQNLFWESYYGGRFEVFQR 267
90403482 321 GNVGRVAGPDINSAYPAVLAELPDPKTLRWKR--------------AKHASISEIETADYGFMTVKVSTDPTREIQPFAV 386
90403523 268 GNVGEVVAPDINSAYPAIMKDLPDPTTLNWNHylnevsdkepfshsINKFGYEEIENGHYGVVKARVTTDSSRMIQPFAC 347
90403482 387 KDEkqDKLVYPSPQNTEITVVKDIFIHAYNQGYVTDYEVIDCWLGYKTEGTTFPFDFIPELYDNRKTAEA-NGLEKRGLL 465
90403523 348 KID--GKVKFPAMTNKVVTVIKPIFEFAVNNGLVTDFELIEAWIGNITDRTSKPFEFIGDMYAERKVFEQlKNKPKKGQL 425
90403482 466 LKIVLNSMYGKTCQTTPKRRELAESTE----LELHESYVPDMSLPKMIREKYSEG--FIESLTAGAWFNPFLASYITGLT 539
90403523 426 LKIVLNSSYGKTCQTTEKRHKHDLDKDgkkiMQAHETQYPRFYLSKKQREALGDDeiIITELEAGKRFNPFFASYITGLT 505
90403482 540 RLELHKQICKHDLEENTVMLATDCVMIEEKPFEESNFVENL---------------VQDGLGYWDMEYKGDAFVLGAGVY 604
90403523 506 RLELHKQVVEHDIEDSTVMFATDCLMVEKEAYENSSFDEQIhvpddslpesefrkeATRSLGAWDFDYEGSAFIVGSGVY 585
90403482 605 QIDfdtcqkgckdncnKFSHKHKVKTRGFSEADLEKGLVNAAEKANGHIEIESTRPQTISEIIWsNEELSQVGNFLEQER 684
90403523 586 EVD-------------TIQGKTKTKTRGFIESNLGDTLKGLAKKHKEAIPLDNERPLTMAEVLI-NTERGSVSEFVENSK 651
90403482 685 KIKPEMDTKRKWS-ENTDFKKLLSTCETSLPLKI 717
90403523 652 KLKPDFDDKRNWNrENPNFHDLLNDKEYSKPIDL 685
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap