Conserved Protein Domain Family
PHA02732

?
PHA02732: PHA02732 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165099
View PSSM: PHA02732
Aligned: 2 rows
Threshold Bit Score: 1773.13
Threshold Setting Gi: 75750458
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51980180    1 MKSGKLIIRLLLLNLLLTSIIL--VATGIKADSGVSAQPIGQATVYTAPytstsFVLNTTVNP-INPIASNIRLFKYPNL 77  
75750458   48 MKVRKVSIVVLVLTLFIIPVIIppAHSSINTSTTYATAYVGETSISSEP-----FILDVANLPwLNPQGSNIRFFEYSNL 122 
51980180   78 TGPIQAFvsqgwspissgsypssrvikvvpgsgvsgvypDYLFNGSMFRVGSvVESTDWGTSpkPYYQGNLLVINTTAVS 157 
75750458  123 TGQLYAY--------------------------------EQLFSKTTWTVNT-VESTGWETL--PYWQNGQLVFNCPSAP 167 
51980180  158 AWGQYIAWYFVPPTTTLNVTIHVVSYPSRNGN---PGIVIYSPNVGNQTYD-GASGFYVLLVDFyNSGIFYHGPSTGYTE 233 
75750458  168 HGGQYIAWRYTPSSNTFNVTIHITSWPSGINNpysPGIAIYSPTVGDQPTDiGTSGFLALLVTF-NGQIWYHETNGNWVE 246 
51980180  234 LYGSLPQPNPNYPFTFTVIFTENSAGNVTVAEVGINGTYTTINVNTPFPWSQIGYIGIRGDINDLLYTSYFAASsgsvfa 313 
75750458  247 LSVVYPTPSTAYPFTFTVTFTENSAGNVTVSTVYINSTAYTVNVNTPFPWSQIGYVGIRGDIDNLFYVSYFAVS------ 320 
51980180  314 qfvPTPSIGEavkslslVESVTWFTSpkPYYQGNLLVINSTTAGS-GQYIAWSFIPSTTTLNVTIHVTSFP---DHNNNP 389 
75750458  321 ---PSPFVNS-------VESTDWKTL--PYWQNGELVINGTGASAgGQYIAWRFTPSSNTFNVTIHITSWPsgiSGGTYP 388 
51980180  390 GIVIYSPNIGNTS-DVYTGFYALDVDFYGNtIWYHGPSTTFTT---LYTSLPQPNPNYPFTFTVIFTENSAGNVTVSEIG 465 
75750458  389 GIEIFSPNVGNQPyAQASGFLALLVTFNGN-IWYHGISGISGCdllKSSAYPTPSTAYPFTFTVTFTENSAGNVTVSTVY 467 
51980180  466 INGTYTTINVNTPFPWTEIGYVGIRgDTGNLFYVSYFAASSSPefaqfvpprelqYPPFVESGYWglSSKVYYQGNLLVL 545 
75750458  468 INSTAHTVNLNTPFPWSQIGYIGIT-SCYDLFYVSYFAVSPSP------------FVNSVESTDW--KTLPYWQNGQLVF 532 
51980180  546 NSTNY--NQYIAWAFTPPTTTLNVTIHVVSYP--VRGVQITGIALFSPNLGYRLQDDIlgpSGFYMLLVSFySGLIVGHG 621 
75750458  533 NVTGAsgSQYIAWRYTPVGNTINVTIHITSFPsgIPSGDNPGIEIFSPNVGDQPYDEV---SGFLSLLVAF-NGNIWYHG 608 
51980180  622 LSPSSVWQtfSTSIPQPNLNYPFTFSVIFTENSAGNVTVSEIGINGTYTTVNVATTFPWSQIGYVAIRGNYMDLFYVSYF 701 
75750458  609 LNGFVLLK--SSAFPTPSTAYPFTFTVTFTENSAGNVTVSTVYINSTAYTLNFNTPFPWSQIGYIGIRGDPSNLFYVSYF 686 
51980180  702 AASSDqpgtypvvfVPSYTVNANPFPIFRFPSTItqaylvynnnsvflsavdaggqfflniplkmqwepftyfglsayql 781 
75750458  687 STTQQ---------LYAYELVTNPYTNTPYTGTV---------------------------------------------- 711 
51980180  782 ltvvnapttgYLAAFPYPLTYNYFTSPGPFtsvpstvitpTFSKTVYPLtnVSIQQLTLFTSAGSVTTSTQAYVLPNIGA 861 
75750458  712 ----------YMAIFPYPISYDVYVSQAPI----------VYSQATLPL--VTVSSPSQVTTQYPIISTSTYMVIPSIGA 769 
51980180  862 WTyasvpyptsvsvivnntvqklsvsgasvtvtasysttviapdnlipppnaqvsvyngtfnkiviSSTSTFTFSTQIVQ 941 
75750458  770 YS----------------------------------------------------------------GNTPLFLYPQMAVS 785 
51980180  942 SGLptfglvlpvwyyvslgtgtigvslvqVPMIlgnklfaflPEVVSTYWGSSpkPYYEGNLLVMNgSNAAAPGQYIAWS 1021
75750458  786 EGI--------------------------VPVI---------PMVESTSWKTL--PYWQNGQLVLD-VAAACSSQYVAWR 827 
51980180 1022 FMPSTTTLNVTIHVVSFPERAS-QPGITIYSPNVGNQSSDNDiVGFYEILVDFyDNTLWYHGPSTNWQSLYTS-LPQPNP 1099
75750458  828 YTPSSNTMNVTIHITSYPSGIQyNPGISIYSPNIGDQPYDYA-SGFLALLVTF-SGNIWYHGTNANWVELRSSaYPTPST 905 
51980180 1100 NYPFTFSVIFTENGAGNITLSEVGINGTYTTINVNTPFPWTEIGYVGIRVDWDNIFYVSYFAASSGPTSITFVSPSYifl 1179
75750458  906 AYPFTFTVTFTENSAGNVTISTVYINSTAYTLNVNTPFPWSQIGYVAIRVDTQNLFYVSYFSISQGSSPFVLVSPSY--- 982 
51980180 1180 nswassyvVPSYLNTPYALSYSVSQTSAQVGQYTLTQGLN-YVSYSFTPGYVATAILYYNST---PVLANLLSPYISykF 1255
75750458  983 --------AQGFVGSQYAYPYFMNTTTVLVNNTAVPKGLSvFSGYMPGANTVFSTFLYMNTTpqsPVLVLMPAPYVS--F 1052
51980180 1256 SSLTLSFS-TATAAMFSNFPIPAPqllssyiptgsvlYQDPITYYISPTTVTMYNTTV----ATSLQSSNASSSSAATTT 1330
75750458 1053 NALSNGFSiTADAQILSLYGYPAT-------------YTNPSFTYTPPGIIGMSGTNTftfkGAQTQLSASTTPPSSTTP 1119
51980180 1331 TPPPSSSTTSTAQSI--SPGQMQIVYNGTTTIRINFVTFPSVSVPKiGQIVAMPIVNSSGAFLYLY-NYNQSANFNVTVS 1407
75750458 1120 TPPSSSSSSSSSSSIstSPNTIQVVLNGSVYVHVPLLFHPALSTPN-GSVLFSTSVNSTGVYISSYvTSAITTPLNVTIE 1198
51980180 1408 YvfSNGTVVTR-TDPVNSIVPLPTITSPVEVRITVENESTTFNITPVQLGsaqlAVQMYNTISNSLPgpfaffgPILANV 1486
75750458 1199 Y--TNGTVIKSfTIEPGQTFQVPLVNGDENVIISYGNHTVTIPISANNVN----VLSLRNAISAVLP-------PIYALP 1265
51980180 1487 IFLIFA----LSAMLRNDLKLVGMGGIVYGVFIAPGLLDLGFPAFIVFPSAIVAVAVGLFALWMSKS 1549
75750458 1266 LFLLFAgsffISLAVRSVPKFAGMGSIIYIFFVAPFLIVIGIPTSVVYGTVVGALIIIIIGLWASRS 1332
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap