Conserved Protein Domain Family
PHA02731

?
PHA02731: PHA02731 
putative integrase; Provisional
Statistics
?
PSSM-Id: 177485
View PSSM: PHA02731
Aligned: 2 rows
Threshold Bit Score: 262.403
Threshold Setting Gi: 75750420
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
195982541   1 MPKYTDDDIFDD-----GAPQVAKGFDRGIDYLDIaaklKKGLKKNYKVLQDTESTANAkrfagsrvIYIIIALLQLKNC 75 
75750420   50 KKKTDETDVLKKilkplGKGKIKGTWDYSVDFVEA----KKTLVSAYKQLYDTNLMPYE--------AYVAILLIQLVNG 117
195982541  76 SRISEAIVATKKFSVSKnlnervvvkiaksekdliDRKTKDKIHTKPRYRDMVFPVDLVDTKIFKYIVKtkywtkfCEFD 155
75750420  118 CRIREAIRAFKTFIESG------------------EREFQLQAQKHGNIRFMIIPDVVKKKATYNAVLT-------IDDE 172
195982541 156 SPRKRVLDFLLGHYECNTHSLRYAGINYLLNvEKRDMNVVAKFVGHANVNQLVLYTQTKALDEIFdRKIVV 226
75750420  173 KLSARIRMFALHYLKANTHSLRYALISYLAK-NGIDPAIIAKITGHKRLDRIITYTQTKDAIEML-RKLAD 241
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap