Conserved Protein Domain Family
PHA02730

?
PHA02730: PHA02730 
ankyrin-like protein; Provisional
Statistics
?
PSSM-Id: 165098
View PSSM: PHA02730
Aligned: 3 rows
Threshold Bit Score: 1152.08
Threshold Setting Gi: 20178375
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20178375   1 MDCGRDC-TILCRLLDEDVTYKKIKLEIETCHNLSKHIDRRGNNALHCYVSNKCDTDIKIVRLLLSRGVERLCRNNEGLT 79 
18640238   1 MDCGRDCiCILCRLLDEDVTYKKIKLEIETCHNLSKHIDRRGNNALHCYVSNKCDTDIKIVRLLLSCGVERLRRNNEGLT 80 
20178582   1 MDCGRDC-TILCRLLDEDVTYKKIKLEIETCHNLSKHIDRRGNNALHCYVSNKCDTDIKIVRLLLSRGVERLCRNNEGLT 79 
20178375  80 PLGVYSKRKYVKSQIVHLLISSYSNASNELTSNINDFDLYSYMSSDNIDLRLLKYLIVDKRIRPSKNTNyYIHCLGLVDI 159
18640238  81 PLGVYSKRRYVKSQIVYLLISSYSNASNELKSNINDFDLYSYMSSDNIDLRLLKYLIVDKRIRPSKNTN-HIHCLGLVDI 159
20178582  80 PLGVYSKRKYVKSQIVHLLISSYSNASNELTSNINDFDLYSYMSSDNIDLRLLKYLIVDKRIRPSKNTNyYIHCLGLVDI 159
20178375 160 YVTTPNPRPEVLLWLLKSECYSTGYVFRSCMYDSDRCKNSLHYYILSHRESE--SLSKDVIKCLIDNNVSIHGRDEGGSL 237
18640238 160 YVTTPNPRPDIVLWLLTSECYNTGYVFRSCMYDSDRCKNSLHYYILSHRESEsqSLSKDVIKCLIDNNVSIHSRDEGGSL 239
20178582 160 YVTTPNPRPEVLLWLLKSECYSTGYVFRSCMYDSDRCKNSLHYYILSHRESE--SLSKDVIKCLIDNNVSIHGRDEGGSL 237
20178375 238 PIQYYWSCSTIDIEIVKLLIKDVDTCSVYDDISQPYIRGVLADYLNKRFRVTPYNVDMEIVNLLIEGRHTLIDVMRSITS 317
18640238 240 PIQYYWYFSTIDIEIVKLLIKDVDTCRVYDDISQPYIRGVLADYLNKRFRVTPYNVDMEIVNLLIEGRHTLIDVMRSITS 319
20178582 238 PIQYYWSCSTIDIEIVKLLIKDVDTCSVYDDISQPYIRGVLADYLNKRFRVTPYNVDMEIVNLLIEGRHTLIDVMRSITS 317
20178375 318 YDSREYNHYIIDNILKRFRQQDESIVQAMLINYLHYGDMVSIPILRCMLDNGATMDKTTDNNYPLHDYFVnNNNIVDVNV 397
18640238 320 YDSRDYNHYIIDNILKRFRQQDESIIQAMLINYLHYGDMVSIPIIQCMLDNGATMDKTTDNNYPLHDYFV-NNNLVDVNV 398
20178582 318 YDSREYNHYIIDNILKRFRQQDESIVQAMLINYLHYGDMVSIPILRCMLDNGATMDKTTDNNYPLHDYFVnNNNIVDVNV 397
20178375 398 VRFIVENNGHMAINHVSNNGRLCMYGLILSRFNNCGYHCYETILIDVFDILSKYMDDIDMIDNENKTLLYYAVDVNNIQF 477
18640238 399 VRFIVENNGHAAVNHISNNGRLCMYGLILSRFNNCGYHCYETILIDVFDILSKYMDDIDMIDNENKTLLYYAVDVNNIQF 478
20178582 398 VRFIVENNGHMAINHVSNNGRLCMYGLILSRFNNCGYHCYETILIDVFDILSKYMDDIDMIDNENKTLLYYAVDVNNIQF 477
20178375 478 ARRLLEYGASVNTTSRSIINTAIQKSSYRRENKTKLVDLLLSYHPTLETMIDAFNRDIRYLYPEPLLACIRYALILDNDF 557
18640238 479 AKRLLEYGASVNATSCSIINTAIQKSSYRRENKTKLVDLLLSYHPTLESMIDAFNRNIYYLYPEPLFACIRYALILDDDF 558
20178582 478 ARRLLEYGASVNTTSRSIINTAIQKSSYRRENKTKLVDLLLSYHPTLETMIDAFNRDIRYLYPEPLLACIRYALILDNDF 557
20178375 558 PSKVKYDIAGrHKELKRYRADINRMKNAYISGVSMFDILFKRNRRHRLRYAKNPTFINFVSNIKWYKKELTSIITETVKN 637
18640238 559 PSKVKYDISG-HKELKRYRADINRMKNAYISGVSMFDIFFKRNRRHRLRYAKNPTFLNFVSDIKWYKKEIKSVITETVKN 637
20178582 558 PSKVKYDIAGrHKELKRYRADINRMKNAYISGVSMFDILFKRNRRHRLRYAKNPTFINFVSNIKWYKKELTSIITETVKN 637
20178375 638 SERIDSIVDNINTDDNLISKLPMEIQREILYYSIK 672
18640238 638 NERIDSIADKINTDDNLISKIPMEIQREILYYSIK 672
20178582 638 SERIDSIVDNINTDDNLISKLPMEIQREILYYSIK 672
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap