Conserved Protein Domain Family
PHA02728

?
PHA02728: PHA02728 
uncharacterized protein; Provisional
Statistics
?
PSSM-Id: 165096
View PSSM: PHA02728
Aligned: 3 rows
Threshold Bit Score: 316.626
Threshold Setting Gi: 66275817
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20178396   1 MTAIRFIACLCLISVFGNCRSvDPYYQPFDKLNITLDIYTYEDLVPYTVDNdlpnpndDTTSFVKIYFKKFWITVMTKWC 80 
66275817   1 MSSIRFIACLYLISIFGNCHE-DPYYQPFNKLNITLDIYTYEDLVPYTVDN-------DTTSFVKIYFKKFWITVMTKWC 72 
18640252   1 MSSIRFIACIYLISVFGNCHE-DPYYQPFDKLNITLDIYTYEDLVPYTVDNdlpnpndDTTSFVKIYFKNFWITVMTKWC 79 
20178396  81 SPFIDTVSVYTSHDNLNIQFYSRDEYDTQSEDKICTIDVKARCDRLTKPEVTVQEEAYRYSLSSDLSCFDSIDLDIDLIE 160
66275817  73 APFIDTVSVYTSHDNLNIEFYTRDEYDTQSEDKICTIDVKARCNHLTKPEVTVQKEAYRYSLSSDLSCFDSIDLDIDLIE 152
18640252  80 ASFIDTVSLYTSHDNLNIQFYSRDEYDTQSEDKICTIDVKARCKHLTKREVIVQQEAYRYSLSSDLSCFDSIDLEIDLIE 159
20178396 161 TNSTDTTVLKSYELMLPKRAKSIHN 185
66275817 153 TNSTDTTVLKSYELMLPKRAKSIHN 177
18640252 160 TNSTDTTVLKSYDLMLPARTKST-- 182
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap